FPV206 is a recombinant protein derived from the Fowlpox virus (FPV), a member of the Chordopoxvirinae subfamily. It is homologous to mammalian G-protein-coupled receptors (GPCRs), which mediate extracellular signal transduction. The recombinant version is produced in E. coli as a full-length, His-tagged protein (1–308 amino acids) and is used in structural and functional studies of viral-host interactions .
| Region | Sequence |
|---|---|
| N-terminal | MNFTGDCLLYAGYEKLSLSLAVVTILIFSSSLILNISALVIGFYTTAPGPMKMYLINLIV |
| Central | SDILFTVTLPLKIDYYYYFFNWRWGEMACRIMSFLSYINTYVSINFMTWISVNRYYAVTR |
| C-terminal | PHKYNSRDNIMRTKIACACTWVIILVPMSSILFVSTTSSDHETKIRCMEYNKVGDSMYLP |
FPV206 is primarily studied in the context of FPV’s genomic complexity and its role in viral pathogenesis. While not directly used in vaccine development (unlike other FPV-encoded proteins such as S1 or gB ), its homology to GPCRs suggests potential roles in modulating host immune responses or cellular signaling.
Genomic Context: FPV206 is one of three FPV-encoded GPCR homologs (FPV021, FPV027, FPV206), highlighting viral adaptation to host environments .
Structural Basis: Recombinant FPV206 is used to study GPCR-like interactions, though crystallization or functional assays remain limited .
Viral Evolution: FPV’s genome exhibits extensive colinearity with other chordopoxviruses, though translocations and inversions (e.g., FPV206’s genomic location) may influence host specificity .
FPV206 is produced via bacterial expression and purified to high homogeneity. Critical handling guidelines include:
Reconstitution: Use deionized sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .
Stability: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .
While FPV206 shares structural motifs with GPCRs, its functional divergence from host receptors is significant. Unlike human GPCRs (e.g., adrenergic, chemokine receptors), FPV206 lacks clear orthologs in mammalian systems, suggesting a specialized role in avian host interactions .
| Feature | FPV206 | Human GPCRs (e.g., β2-adrenergic receptor) |
|---|---|---|
| Ligand Specificity | Unknown | Well-characterized (e.g., epinephrine) |
| Signaling Pathway | Hypothetical | Gs/Gi-mediated cAMP signaling |
| Thermostability | Requires stabilization | Stable under physiological conditions |
| Structural Studies | Limited (no crystal structure) | Extensive (e.g., β2-adrenergic receptor) |
Research on FPV206 is nascent, with opportunities to:
Elucidate Function: Investigate interactions with avian host G proteins or cytokines.
Structural Biology: Engineer stabilized variants for X-ray crystallography or cryo-EM.
Therapeutic Potential: Explore FPV206 as a vaccine component or adjuvant, leveraging FPV’s established safety profile in poultry .
KEGG: vg:1486778
FPV206 is a G-protein coupled receptor (GPCR) homolog encoded by the Fowlpox virus genome. GPCRs constitute a large family of membrane proteins responsible for transducing diverse chemical stimuli to alter cell states. In the context of Fowlpox virus, FPV206 represents one of several viral genes that may play roles in viral pathogenesis, immune evasion, or viral replication by potentially mimicking or interfering with host cell signaling pathways. The study of viral GPCR homologs like FPV206 provides insights into virus-host interactions and potential therapeutic targets .
Recombinant Fowlpox viruses are typically constructed through homologous recombination techniques. The general procedure involves:
Creation of a recombination vector containing the gene of interest flanked by Fowlpox virus sequences
Infection of permissive cells (typically chicken embryo fibroblasts) with parent Fowlpox virus
Transfection of infected cells with the recombination vector
Selection of recombinant viruses using marker genes
Plaque purification to isolate pure recombinant virus
For example, in established protocols, primary chicken embryo skin cells are infected with parent Fowlpox virus and then transfected with recombination vectors using transfection agents like Lipofectamine. The recombinant viruses are subsequently isolated after multiple rounds of plaque purification under selection conditions .
Several selection systems have been developed for isolating recombinant Fowlpox viruses:
Guanine phosphoribosyltransferase (gpt) selection system: This system uses the Escherichia coli gpt gene as a selectable marker. Cells infected with recombinant viruses expressing gpt can grow in medium containing mycophenolic acid, xanthine, and hypoxanthine (MXH). This selective medium allows for the growth of only recombinant viruses, as the parent virus lacking gpt cannot proliferate under these conditions .
Fluorescent protein expression: Genes encoding fluorescent proteins such as GFP or mCherry can be incorporated into recombinant Fowlpox viruses, allowing for visual identification of recombinant virus-infected cells under fluorescence microscopy .
Antibiotic resistance: Selection markers like blasticidin S deaminase (BSD) can be used. For instance, the FPV-HIV-GFP construct was selected using blasticidin S at 2 μg/ml concentration .
Several non-essential loci in the Fowlpox virus genome have been identified as suitable insertion sites for foreign genes:
The choice of insertion site can impact foreign gene expression levels and stability of the recombinant virus .
Assessing functional activity of viral GPCR homologs requires sophisticated experimental approaches:
Barcoded transcriptional reporter systems: For G-protein signaling assessment, transcriptional reporters controlled by response elements (e.g., cAMP response elements for Gs-coupled receptors) can be employed. These systems allow quantification of signaling via RNA-seq analysis of the reporter transcripts .
Stable cell line development: Creating stable cell lines with controlled receptor expression is crucial for accurate assessment. This can be achieved using landing pad systems for site-specific integration at transcriptionally silent loci (e.g., H11 safe-harbor locus) to avoid placing reporters within transcribed genes .
Knockout of endogenous receptors: To prevent interference from endogenous signaling, knockout of related endogenous receptors is recommended. For instance, when studying β2AR signaling, the endogenous ADRB2 gene was knocked out to verify specific signal induction upon agonist treatment .
Dose-response studies: Testing receptor activation across multiple ligand concentrations provides insights into signaling efficiency and potential bias. This approach has been effectively used for characterizing GPCR signaling properties .
Deep mutational scanning (DMS) represents a powerful approach for comprehensive structural and functional characterization of viral GPCR homologs:
Comprehensive single amino acid substitution libraries: Testing all possible amino acid substitutions at each position can identify residues critical for receptor function, stability, and ligand binding .
Integration with structural information: Results from DMS can complement other structural techniques (X-ray crystallography, Cryo-EM, molecular dynamics) to enhance understanding of GPCR structure-function relationships .
Identification of key functional domains: DMS can reveal previously uncharacterized structural elements. For example, in GPCR studies, a previously uncharacterized structural latch spanning the first two extracellular loops was identified, which is conserved across Class A GPCRs .
Unsupervised learning approaches: Applied to DMS data, these methods can identify residues critical for signaling, including major structural motifs and molecular interfaces .
This methodology is particularly valuable when direct structural information is unavailable but functional reporters exist, which is the case for most GPCRs and potentially applicable to viral homologs like FPV206 .
Several methodological challenges must be addressed when analyzing mutational data:
Expression vs. function discrimination: High-throughput functional assays may not directly quantify cell-surface expression, making it difficult to distinguish between mutations affecting G-protein signaling and those affecting cell-surface expression .
Internalization effects: Mutations that increase signaling in functional assays might actually work by reducing GPCR internalization rather than increasing intrinsic receptor activity .
Expression level control: Expressing receptor variants in a genomic context at controlled copy numbers helps dampen expression-related artifacts typically associated with transient transfection assays .
Physiological relevance of expression alterations: Expression level changes can affect signaling dynamics and may be physiologically relevant. For example, GPCR expression levels can dramatically impact the cell's response to ligands .
To address these challenges, complementary approaches that directly measure receptor expression alongside functional readouts should be considered for comprehensive characterization of viral GPCR homologs.
Effective vaccination experiments with recombinant Fowlpox vectors require careful consideration of several factors:
Administration route: For Fowlpox virus vaccines, the wing-web vaccination route is commonly employed, with multiple punctures using a hypodermic needle to ensure adequate vaccine delivery .
Prime-boost strategies: A two-dose vaccination regimen is typically recommended, with a booster vaccination administered approximately two weeks after the primary vaccination .
Challenge studies: To assess protective efficacy, vaccinated animals can be challenged with the relevant pathogen. For instance, in IBDV studies, intranasal challenge with 10^2.3 EID₅₀ of virus has been used .
Comprehensive assessment of protection: Multiple parameters should be evaluated post-challenge:
GPCRs, including viral homologs, can signal through multiple pathways. Investigating signaling bias requires specialized approaches:
Multiplexed transcriptional reporter systems: By leveraging transcriptional reporters for different signaling pathways (e.g., G protein-dependent vs. arrestin-dependent), researchers can assess pathway-specific activation in parallel .
Comparative ligand profiling: Testing multiple ligands can reveal differences in pathway engagement, identifying biased signaling properties .
Mutational analysis: Specific mutations can differentially impact coupling to various downstream pathways, providing insights into structural determinants of biased signaling .
Integration with trafficking studies: Since receptor internalization and trafficking can influence signaling outcomes, combining signaling assays with trafficking measurements provides a more complete picture of receptor function .
Understanding signaling bias in viral GPCR homologs may reveal important aspects of viral pathogenesis and potential strategies for therapeutic intervention.
Precise amplification and cloning protocols are essential for successful recombinant virus generation:
First round amplification:
Second round amplification:
Gel isolation of amplicons using 1% agarose gels
Quantification of library concentrations using TapeStation and Qubit
Sequencing verification with paired-end reads (150 bp on NextSeq 500 or 250 bp on MiSeq)
Following these optimized conditions ensures high-quality amplification products for downstream applications in recombinant virus construction.
Effective data presentation is crucial for communicating GPCR signaling study results:
Results section organization: When reporting results related to multiple parameters, organize them under parameter-specific subheadings to facilitate reading and comprehension .
Terminology precision: Reserve terms like "increased" or "decreased" only for statistically significant changes. For insignificant changes, use more neutral descriptive language .
Data table construction: Present comparative data in well-structured tables rather than lists. Each table should be self-explanatory with clear column and row headings .
| Data Category | Basic Format | Example Application for GPCR Studies |
|---|---|---|
| Signaling data | Condition vs. Response | Dose-response relationships for different receptor variants |
| Mutational effects | Mutation vs. Functional Impact | Effects of specific mutations on receptor activation or expression |
| Expression analysis | Condition vs. Expression Level | Receptor surface expression under different conditions |
Several innovative approaches show promise for advancing viral GPCR research:
Integration of DMS with structural biology: Combining deep mutational scanning data with cryo-EM or X-ray crystallography can provide unprecedented insights into structure-function relationships .
Multiplexed pathway analysis: Developing systems to simultaneously monitor multiple signaling pathways can reveal the full spectrum of GPCR signaling capabilities and biases .
Identification of allosteric modulators: Characterizing mutations that stabilize specific conformations or alter receptor activity can aid in discovering allosteric binding sites for therapeutic targeting .
Large-scale pharmacogenomic mapping: Creating stable cell libraries expressing GPCR variants and profiling them against small molecule libraries can build empirical maps of receptor-drug interactions .
Cross-species comparative analysis: Comparing viral GPCR homologs across different viral families may reveal conserved mechanisms of host manipulation and potential broad-spectrum therapeutic targets.
Determining the role of viral GPCR homologs in pathogenesis requires multi-faceted approaches:
Generation of receptor knockout viruses: Creating recombinant viruses with deleted or inactivated GPCR homologs allows assessment of the receptor's contribution to viral replication and pathogenesis in relevant models .
Complementation studies: Reintroducing wild-type or mutant receptors into knockout viruses can confirm specific roles and identify critical functional domains .
Host range and tissue tropism analysis: Examining whether receptor deletion affects viral host range or tissue tropism can reveal roles in host adaptation or tissue-specific replication .
Immune response modulation: Assessing how receptor presence/absence affects host immune responses may uncover immunomodulatory functions .
Comparative studies with other poxvirus GPCRs: Functional comparison with related receptors from other poxviruses could identify conserved versus unique pathogenic mechanisms.
By integrating these experimental approaches, researchers can establish whether and how viral GPCR homologs contribute to pathogenesis, potentially identifying new targets for antiviral intervention.
When presenting histopathological findings from studies involving viral GPCRs or recombinant Fowlpox viruses, researchers should follow these guidelines:
Tabular presentation: Histopathological diagnoses should be organized in clear tables with appropriate categorization by relevant variables (e.g., sex, treatment groups).
| Histopathological Finding | Control Group (n=X) | GPCR-expressing Group (n=Y) | GPCR-deleted Group (n=Z) |
|---|---|---|---|
| Finding 1 | n (%) | n (%) | n (%) |
| Finding 2 | n (%) | n (%) | n (%) |
| Total | n (100%) | n (100%) | n (100%) |
Comprehensive documentation: Include both positive and negative findings. For example, statements like "In none of the patients/samples were postoperative complications seen" provide important negative results .
Quantitative assessment: Where possible, quantify histopathological changes rather than using purely descriptive terms, allowing for statistical comparisons between groups .
Image documentation: Include representative histological images with appropriate magnification indicators and clear labeling of key features .