Recombinant Fowlpox virus Immunodominant envelope protein p35 (FPV140)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Fowlpox Virus Immunodominant Envelope Protein p35 (FPV140)

Recombinant Fowlpox virus Immunodominant envelope protein p35 (FPV140) refers to a protein encoded by the FPV140 gene in the fowlpox virus (FPV) . The FPV140 gene is highly conserved among different FPV isolates and encodes an envelope protein .

Significance and Applications

  1. Diagnostic Tool: Recombinant FPV140 protein is useful in differentiating avian FPV isolates from other common avian pathogens . An indirect ELISA (enzyme-linked immunosorbent assay) that uses anti-FPV140 polyclonal antibodies can distinguish FPV from other avian pathogens like Mycoplasma gallisepticum, infectious laryngotracheitis virus, avian influenza virus, infectious bursal disease virus, and avian infectious bronchitis virus .

  2. Vaccine Development: Recombinant fowlpox viruses (rFPV) can express antigens from other viruses, thereby acting as vaccines against multiple diseases . For example, rFPV can express the hemagglutinin (HA) antigen of avian influenza virus, providing immunity against avian influenza in chickens .

  3. Immunological Studies: rFPV can elicit various host responses, including the expression of Toll-like receptors (TLRs), type I interferons, and pro-inflammatory cytokines, which are associated with adaptive immune responses .

Construction and Production

  1. Cloning and Expression: The FPV140 gene from FPV isolates can be cloned, and recombinant plasmids such as pET-FPV140 can be constructed and transformed into Escherichia coli .

  2. Protein Purification: Optimal expression conditions for the FPV140 gene can be developed to purify the recombinant protein . The purified protein is then used to produce polyclonal antibodies in animals like rabbits .

ELISA Development

  1. Antibody Production: Purified FPV140 recombinant protein is used to produce rabbit polyclonal antibodies .

  2. Assay Design: An indirect ELISA is developed using the anti-FPV140 polyclonal antibody to detect FPV in clinical samples, differentiating it from other avian pathogens .

Clinical Trials and Immunogenicity

  1. Melanoma Antigen Studies: Recombinant fowlpox viruses encoding melanoma-associated antigens like gp100 have been evaluated for immunological responses and therapeutic effectiveness in patients with metastatic melanoma .

  2. Immune Responses: Fowlpox viruses can effectively immunize against multiple epitopes in the same protein, and modifying anchor residues of peptides can improve immunogenicity .

Advantages of Recombinant Fowlpox Virus Vaccines

  1. Multi-Antigen Expression: rGPV can express multiple exogenous genes, making it suitable for creating multivalent vaccines . For instance, a recombinant goat pox virus (rGPV) expressing the F gene of PPRV and the P12A3C gene of FMDV has been constructed as a live vector vaccine .

  2. Improved Antibody Levels: Recombinant GPV can significantly improve antibody levels against multiple diseases, showing potential as a new recombinant live vector vaccine .

Data Presentation

Data concerning Recombinant Fowlpox virus Immunodominant envelope protein p35 (FPV140) is best presented through tables and figures that help to organize complex information, allowing for easy comparison and interpretation . Tables are useful for presenting precise numerical values and specific data, while figures can illustrate trends and relationships .

ApplicationDescription
Diagnostic ToolELISA using anti-FPV140 polyclonal antibodies distinguishes FPV from other avian pathogens .
Vaccine DevelopmentrFPV expressing HA antigen of avian influenza virus confers immunity against avian influenza in chickens .
Immunological StudiesrFPV elicits TLRs, type I interferons, and pro-inflammatory cytokines .
Multi-Antigen ExpressionrGPV expressing F gene of PPRV and P12A3C gene of FMDV as a live vector vaccine .
Improved Antibody LevelsRecombinant GPV improves antibody levels against PPR, FMD, and GP .
Clinical Trials (Melanoma)Fowlpox viruses encoding gp100 melanoma antigen evaluated for immunological responses and therapeutic effectiveness in metastatic melanoma patients .
Epitope-Specific Immune ResponseFowlpox viruses effectively immunize against multiple epitopes; modifying anchor residues of peptides improves immunogenicity .
Data PresentationUse tables for precise numerical values and specific data; use figures for trends and relationships .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FPV140; Immunodominant envelope protein p35; Ag35; Virion envelope protein p35
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV140
Target Protein Sequence
MAPGDKKQIIFVITTIGRPSSTVVPFKNLEVSEWSYKKGIKNGYDDYRDPPSPKPLPKSK QEPNADDKVGDIEYDEMVSVRDGYYSDVCRLTCTEDTKIFIADHISLWRYIMDNAEKLPN YVVIMEDDNTITGEGFITNLDNITKVLNDNNVDILQLVTHTKLLKDRNSQHLMLLPDLEA FKGSFDVSLSAYIIRQEAVRKLYSYFTNNKPSFDISLEILRIENTLGITRYVVDNDRYVY HDYKLANEFMKNKKNRLSIKSRIDGWIMDNWPSFYHRMYYPLFSVFGKYDITMMFLIAIV IIIGLAIFDINNKLLWLLSGVFLAYSM
Uniprot No.

Target Background

Function
An envelope protein mediating virion attachment to target cells through cell surface binding.
Database Links

KEGG: vg:1486688

Protein Families
Poxviruses protein p35 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the FPV140 protein and how is it identified structurally?

The FPV140 protein is a 35-kDa immunodominant structural protein of Fowlpox virus that functions as an envelope protein. It is the FWPV homolog of Vaccinia virus (VACV) H3L. The protein is part of a non-glycosylated 30- and 35-kDa protein doublet present in the intracellular mature virus membrane. N-terminal sequencing has definitively identified the 35-kDa protein as being encoded by the FPV140 gene . Researchers typically characterize this protein through various molecular techniques, including:

  • SDS-PAGE for molecular weight determination

  • Western blotting with monoclonal antibodies (MAbs)

  • Protein sequencing focusing on the N-terminal region

  • Immunofluorescence for localization studies

When performing structural identification, researchers should first purify the virus using density gradient centrifugation, followed by protein extraction and analysis using the techniques mentioned above.

How does FPV140 protein relate to other immunodominant proteins in Fowlpox virus?

FPV140 protein (p35) is one of three major immunodominant structural proteins identified in Fowlpox virus. The relationship between these proteins creates a comprehensive structural and immunological profile:

ProteinMolecular WeightEncoding GeneHomology to VACVLocalizationCharacteristics
p3535-kDaFPV140H3LViral membraneNon-glycosylated, associates with viral factories
Core protein39-kDaFPV168A4LViral coreKey structural component
p6363-kDaFPV191Related to ATI proteinsViral matrixForms covalently linked dimers and oligomers

These proteins function cooperatively in viral structure and are targeted by the immune system during infection. Methodologically, researchers should investigate protein-protein interactions using co-immunoprecipitation or proximity ligation assays to better understand how FPV140 interacts with other viral components .

What PCR-based approaches are recommended for amplifying and validating the FPV140 gene?

Researchers investigating FPV140 should implement targeted PCR amplification strategies. Based on established protocols, the following approach is recommended:

  • Extract total viral DNA using standard phenol-chloroform extraction or commercial viral DNA isolation kits

  • Design primers that flank the FPV140 gene region

  • Implement PCR conditions as follows:

    • Initial denaturation: 95°C for 5 minutes

    • 35 cycles of: 95°C for 15 seconds, 46-50°C for 15 seconds (primer-dependent), 72°C for appropriate extension time

    • Final extension: 72°C for 7 minutes

For validation of results, researchers should:

  • Confirm amplicon size through gel electrophoresis (expected size dependent on primer design)

  • Perform restriction enzyme analysis to verify the identity of the amplified fragment

  • Sequence the PCR product to confirm identity with reference sequences

Specific primers such as those targeting conserved regions between FPV139 and FPV141 genes, like M2904 (5'-GAAGTAGAGTTACGGTTC-3') and M2912 (5'-GGTGATCCATTTCCATTTC-3'), can be used to amplify regions containing the FPV140 gene .

How can recombinant FPV140 protein be effectively expressed and purified for immunological studies?

The expression and purification of recombinant FPV140 protein requires a systematic approach tailored to this specific viral envelope protein:

  • Expression system selection:

    • Bacterial systems (E. coli BL21): Suitable for primary structure studies but may lack post-translational modifications

    • Insect cell systems (Sf9, High Five™): Preferred for maintaining conformational epitopes

    • Mammalian cell systems: Ideal for studies requiring authentic folding and membrane insertion

  • Vector design considerations:

    • Include a strong promoter (T7, CMV, or polyhedrin depending on the system)

    • Add affinity tags (6xHis, GST) at the N-terminus to avoid interfering with membrane-binding domains

    • Incorporate TEV protease sites for tag removal if necessary

  • Optimization parameters:

    • Temperature: Typically lower temperatures (16-28°C) improve proper folding

    • Induction conditions: For IPTG-inducible systems, 0.1-0.5 mM IPTG for 4-16 hours

    • Harvest timing: Monitor expression levels via Western blot

  • Purification protocol:

    • Membrane solubilization using detergents (1% Triton X-100 or n-Dodecyl β-D-maltoside)

    • Affinity chromatography as primary capture step

    • Size exclusion chromatography for final polishing

    • Validate protein integrity by SDS-PAGE and immunoblotting with anti-FPV140 antibodies

Researchers should verify the immunological activity of purified protein through ELISA binding assays with sera from FWPV-infected animals to confirm epitope preservation.

What approaches can resolve contradictory findings when characterizing FPV140 function in different avian species?

When addressing contradictory findings regarding FPV140 function across avian species, researchers should implement a multi-faceted investigative strategy:

  • Comparative genomic analysis:

    • Sequence FPV140 homologs from multiple avian host-adapted strains

    • Perform phylogenetic analysis to identify host-specific clustering

    • Map amino acid substitutions to functional domains

  • In vitro binding studies:

    • Express recombinant FPV140 from various strains

    • Test binding affinity to cell receptors from different avian species

    • Quantify binding kinetics using surface plasmon resonance

  • Mutational analysis:

    • Generate site-directed mutations at positions varying between strains

    • Evaluate effects on protein function using cell entry assays

    • Correlate mutations with host range alterations

  • Cross-species infection experiments:

    • Develop recombinant viruses with swapped FPV140 genes between strains

    • Compare infection efficiency in cells from different avian species

    • Monitor viral factory formation and membrane localization

When contradictions appear in the literature, researchers should first meticulously compare experimental conditions, viral isolates, and host cell types used in conflicting studies. This approach has previously helped resolve apparent contradictions in FPV studies from different geographical regions .

How can restriction enzyme analysis (REA) and sequencing be combined to characterize FPV140 genetic variability?

To comprehensively characterize FPV140 genetic variability, researchers should implement a dual analytical approach combining REA and sequencing:

  • REA protocol:

    • Amplify the FPV140 gene region using PCR with high-fidelity polymerase

    • Select restriction enzymes based on predicted cut sites using in silico analysis

    • Recommended enzymes include EcoR V and Mse I, which have demonstrated utility in differentiating FPV isolates

    • Analyze restriction patterns using high-resolution gel electrophoresis (3-4% agarose)

  • Sequencing approach:

    • Perform both Sanger sequencing for individual samples and NGS for population-level analysis

    • Target the complete FPV140 coding sequence plus 100bp flanking regions

    • Analyze sequences using alignment software (CLUSTAL W, MUSCLE)

    • Generate phylogenetic trees using maximum likelihood or Bayesian inference methods

  • Integrated analysis workflow:

    • Compare REA patterns across isolates to identify preliminary groupings

    • Confirm groupings with sequence data and identify specific nucleotide changes

    • Correlate genetic variations with geographical origin and host species

    • Map mutations to functional domains using protein structure prediction tools

This integrated approach has proven effective in characterizing FPV isolates, revealing that isolates from the same geographical region often show 99-100% nucleotide similarity despite host species differences . The methodology provides both rapid screening (REA) and detailed characterization (sequencing) capabilities.

What are the most effective immunological assays for evaluating immune responses to recombinant FPV140 protein?

Researchers assessing immune responses to recombinant FPV140 protein should employ a comprehensive panel of immunological assays:

  • Antibody response evaluation:

    • Enzyme-Linked Immunosorbent Assay (ELISA): Develop with purified recombinant FPV140 as capture antigen

    • Western blotting: For confirming antibody specificity

    • Virus neutralization tests: To assess functional antibody responses

    • Avidity assays: Using chaotropic agents to determine antibody maturation

  • Cell-mediated immunity assessment:

    • T-cell proliferation assays using FPV140 peptide pools

    • ELISpot for enumerating antigen-specific T-cells

    • Intracellular cytokine staining (ICS) to evaluate T-cell functionality

    • Cytotoxicity assays to measure CD8+ T-cell killing of FPV140-expressing targets

  • Protocol optimization considerations:

    • Antigen concentration: Titrate between 0.5-5 μg/ml for coating ELISA plates

    • Serum dilutions: Start with 1:100 and perform serial dilutions

    • Positive controls: Include sera from FWPV-infected birds

    • Cut-off determination: Use ROC curve analysis with known positive and negative samples

  • Comparative analysis approach:

    • Measure responses to whole virus versus recombinant protein

    • Compare native versus denatured protein to assess conformational epitopes

    • Evaluate cross-reactivity with homologous proteins from related avian poxviruses

This multi-parameter approach provides comprehensive characterization of both humoral and cellular responses, essential for vaccine development and immunopathology studies .

How should researchers design experiments to evaluate FPV140's role in viral entry and infection?

To investigate FPV140's role in viral entry and infection, researchers should implement a systematic experimental design approach:

  • FPV140 knockdown/knockout studies:

    • Design CRISPR-Cas9 targeting of FPV140 in the viral genome

    • Generate conditional expression systems using tet-on/off regulation

    • Develop dominant-negative mutants to interfere with wild-type function

    • Quantify effects on virus binding, entry, and replication kinetics

  • Binding and internalization assays:

    • Fluorescently label purified FPV140 protein and track cell binding

    • Perform competition assays with anti-FPV140 antibodies

    • Utilize confocal microscopy to visualize entry events in real-time

    • Employ electron microscopy to observe membrane interaction events

  • Host-receptor identification:

    • Perform co-immunoprecipitation with cell membrane fractions

    • Implement proximity labeling techniques (BioID, APEX)

    • Conduct yeast two-hybrid screening with FPV140 as bait

    • Validate interactions using surface plasmon resonance

  • Experimental design matrix:

ExperimentVariables to ControlMeasurementsExpected Outcomes
Cell bindingTemperature, time, protein concentrationBound protein quantitySaturation curves
Entry kineticsSynchronization of infectionTime to nuclear entryEntry rate constants
Inhibition studiesAntibody concentration, timing of additionPercent inhibitionIC50 values
Cross-species testingCell types from different avian hostsBinding efficiencyHost range determinants

When designing these experiments, researchers should include appropriate controls such as other viral envelope proteins (e.g., from the 63-kDa protein) and ensure that recombinant proteins maintain native conformations .

What are the recommended approaches for evaluating FPV140 as a potential vaccine antigen?

Evaluating FPV140 as a vaccine antigen requires a comprehensive approach spanning in silico prediction through in vivo challenge studies:

  • Epitope prediction and validation:

    • Employ computational algorithms to identify B-cell and T-cell epitopes

    • Synthesize predicted epitope peptides for screening

    • Validate epitope immunogenicity using sera from FWPV-infected birds

    • Map conformational epitopes using hydrogen-deuterium exchange mass spectrometry

  • Vaccine platform selection and optimization:

    • Subunit vaccines: Purified recombinant FPV140

    • DNA vaccines: Codon-optimized FPV140 gene in mammalian expression vector

    • Viral vector vaccines: FPV140 gene inserted into non-replicating viral vectors

    • Test different adjuvants (aluminum salts, oil-in-water emulsions, TLR agonists)

  • In vitro assessment:

    • Antibody production in culture systems

    • Antigen presentation assays with avian dendritic cells

    • T-cell activation using avian splenocytes or PBMCs

  • In vivo evaluation protocol:

    • Immunization schedule: Prime-boost approaches with 2-3 week intervals

    • Dose response: Test 10-100 μg protein or 50-200 μg DNA per immunization

    • Sampling timeline: Pre-immune, post-prime, post-boost, pre-challenge, post-challenge

    • Challenge model: Use virulent FWPV strain with established pathogenicity

  • Protection assessment metrics:

    • Clinical scoring system for lesion development

    • Viral load quantification in tissues by qPCR

    • Histopathological evaluation of lesions

    • Correlation between immune parameters and protection

This methodological framework aligns with successful approaches used to evaluate commercial FPV vaccines, which have demonstrated protection rates of 85-100% against challenge .

What bioinformatic approaches best identify conserved and variable regions in FPV140 across different Fowlpox isolates?

Researchers seeking to identify conserved and variable regions in FPV140 should implement a multi-layered bioinformatic analysis pipeline:

  • Sequence acquisition and alignment:

    • Retrieve FPV140 sequences from public databases (GenBank, UniProt)

    • Generate new sequences from field isolates using the PCR protocols outlined previously

    • Perform multiple sequence alignment using MAFFT or MUSCLE with iterative refinement

    • Visualize alignments using Jalview or similar tools with conservation highlighting

  • Conservation analysis:

    • Calculate per-site entropy scores to quantify variability

    • Generate conservation plots using sliding window approaches (10-20 amino acids)

    • Identify absolutely conserved motifs using pattern recognition algorithms

    • Compare intra-species (FWPV strains) vs. inter-species (avian poxviruses) conservation

  • Structural mapping:

    • Generate homology models of FPV140 based on VACV H3L structure

    • Map conservation scores onto 3D structure

    • Identify surface-exposed variable regions versus buried conserved cores

    • Predict conformational epitopes using structural data

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify positions under positive/negative selection

    • Implement PAML, FUBAR, or MEME algorithms for codon-based analyses

    • Correlate selection hotspots with known functional domains or host-specificity

This approach has been validated in comparative studies of fowlpox isolates, where nucleotide sequence analysis revealed 99-100% similarity among isolates despite diverse avian host origins .

How can researchers effectively troubleshoot inconsistent results in FPV140 recombinant protein expression systems?

When troubleshooting inconsistent results in FPV140 recombinant protein expression, researchers should implement a systematic diagnostic and optimization workflow:

  • Expression vector integrity verification:

    • Re-sequence the entire expression construct

    • Confirm the absence of unintended mutations or frame shifts

    • Verify promoter functionality using reporter gene controls

    • Check codon usage optimization for the expression system

  • Expression conditions optimization matrix:

ParameterVariables to TestMonitoring MethodOutcome Assessment
Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blotSoluble vs. insoluble fraction ratio
Induction time4h, 8h, 16h, 24hTime-course samplingOptimal harvest point
Inducer concentration0.1, 0.5, 1.0 mM IPTGDose-response curveExpression level vs. toxicity
Media compositionStandard, enriched, minimalComparative yieldsCost-effectiveness ratio
  • Protein solubility enhancement strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK)

    • Add solubility tags (MBP, SUMO, thioredoxin)

    • Test detergent panels for membrane protein solubilization

    • Implement refolding protocols from inclusion bodies

  • Purification troubleshooting:

    • Optimize lysis conditions (sonication vs. chemical lysis)

    • Test different buffer systems and pH conditions

    • Evaluate various detergents for membrane protein extraction

    • Implement on-column refolding techniques

  • Quality control checkpoints:

    • Circular dichroism to verify secondary structure

    • Analytical size exclusion to assess aggregation state

    • Mass spectrometry to confirm identity and modifications

    • Functional binding assays to verify activity

This systematic approach addresses the unique challenges of expressing viral envelope proteins like FPV140, which often require specific conditions to maintain native conformation and immunological properties .

What are the best practices for designing cross-protection studies involving FPV140 against diverse fowlpox virus strains?

Designing rigorous cross-protection studies involving FPV140 requires methodical planning across multiple experimental dimensions:

  • Strain selection criteria:

    • Include geographically diverse isolates (minimum 3-5 distinct regions)

    • Select strains with documented genetic variation in FPV140

    • Include both recent field isolates and historical reference strains

    • Characterize all strains by sequencing and restriction enzyme analysis before use

  • Immunization protocol design:

    • Test both homologous and heterologous prime-boost regimens

    • Include appropriate control groups:

      • Positive control: Commercial vaccine

      • Negative control: Adjuvant-only or vector-only

      • Internal control: Whole-virus preparation

  • Challenge model standardization:

    • Titrate challenge dose for each strain to achieve consistent disease in controls

    • Standardize challenge route (wing-web scarification preferred)

    • Establish scoring system for clinical signs with blinded assessment

    • Define consistent sampling timepoints (e.g., 3, 7, 14 days post-challenge)

  • Comprehensive outcome measures:

    • Clinical protection scoring

    • Viral load quantification using qPCR targeting conserved genes

    • Histopathological examination of lesions

    • Antibody titer measurements (both binding and neutralizing)

    • T-cell responses to whole virus and FPV140

  • Cross-reactivity evaluation:

    • Test sera from immunized animals against multiple FPV strains

    • Perform epitope mapping to identify strain-specific versus conserved regions

    • Analyze breakthrough infections for evidence of immune escape mutations

This approach builds upon established vaccination evaluation methods that have demonstrated variable protection rates (85-100%) among commercial vaccines when challenged with field isolates . The key distinguishing feature in advanced research is the comprehensive immunological profiling and genetic characterization of breakthrough infections.

What are the future research directions for FPV140 in FWPV vaccine development?

Future research on FPV140 in FWPV vaccine development should prioritize several interconnected directions:

  • Structure-function relationship elucidation:

    • Determine the high-resolution crystal structure of FPV140

    • Map functional domains involved in host cell attachment

    • Identify regions essential for viral assembly versus dispensable regions

    • Engineer stabilized forms with enhanced immunogenicity

  • Improved delivery platforms:

    • Develop nanoparticle-based presentation of FPV140 epitopes

    • Explore mRNA vaccine approaches for FPV140 expression

    • Optimize viral vector systems for delivery to target tissues

    • Design polyvalent vaccines incorporating multiple FWPV immunogens

  • Cross-species protection strategies:

    • Identify broadly protective epitopes shared across avian poxviruses

    • Engineer chimeric proteins incorporating protective regions from multiple strains

    • Evaluate heterologous prime-boost strategies

    • Develop consensus sequence antigens to address strain variation

  • Advanced efficacy metrics:

    • Establish correlates of protection beyond antibody titers

    • Develop challenge models that better reflect field conditions

    • Implement systems vaccinology approaches to understand protection mechanisms

    • Evaluate long-term protection and duration of immunity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.