Recombinant Fowlpox virus L5 homolog (FPV132)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FPV132; FP6; L5 homolog; Protein FPV132
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV132
Target Protein Sequence
MDRNINFSPVFIEPRFKHEFLLSPQRYFYILVFEVIVALIILNFFFKEEILYTFFPLAKP SKNSINSLLDRTMLKCEEDGSLMISRPSGIYSALSLDGSPVRISDCSLLLSSINGASSST SPYSIFNRR
Uniprot No.

Target Background

Function
The envelope protein of the entry-fusion complex mediates viral membrane fusion with the host cell membrane during viral entry. It also plays a role in cell-cell fusion (syncytium formation).
Database Links

KEGG: vg:1486680

Protein Families
Chordopoxvirinae L5 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is Recombinant Fowlpox virus L5 homolog (FPV132)?

Recombinant Fowlpox virus L5 homolog (FPV132) is a 129 amino acid protein (UniProt accession P15914) derived from the Fowlpox virus genome. As a recombinant protein, it can be produced with an N-terminal histidine tag in bacterial expression systems such as E. coli for research applications . FPV132 is one of the 260 open reading frames encoded within the 288-kbp Fowlpox virus genome, which contains identical 9.5-kbp inverted terminal repeats . The protein represents one component of this complex viral system that has evolved specialized mechanisms for avian host infection.

Methodologically, researchers should approach FPV132 characterization through multiple techniques including sequence analysis, recombinant expression optimization, and functional assays that reflect its native activities in the viral life cycle.

How does FPV132 compare to other viral protein homologs?

When comparing FPV132 to homologous proteins in other poxviruses, researchers should consider both structural and functional conservation. The Fowlpox virus genome exhibits organizational similarities to other chordopoxviruses (ChPVs) despite its significantly larger size (260-309 kbp versus 178-191 kbp for other ChPVs) . This genomic expansion in Fowlpox virus is largely attributed to the presence of numerous cellular homologs and multigene families that likely contribute to host adaptation mechanisms.

Virus FamilyGenome SizeL5 Homolog CharacteristicsMethodological Considerations
Fowlpox virus (Avipoxvirus)288 kbpFPV132 (129aa)Avian host range factors
Orthopoxviruses178-191 kbpConserved structural rolesMammalian host adaptations
Other AvipoxvirusesVariableSpecies-specific variationsComparative functional analysis

Methodologically, researchers should employ sequence alignment, phylogenetic analysis, and structural prediction tools to identify conserved domains. Functional complementation studies can determine whether FPV132 can substitute for L5 homologs in other poxviruses, providing insights into conserved versus specialized functions.

What expression systems are optimal for producing recombinant FPV132 protein?

Expression SystemAdvantagesLimitationsMethodological Considerations
E. coliRapid growth, high yields, cost-effectiveLimited post-translational modificationsCodon optimization, solubility tags
Insect cellsBetter folding, more authentic modificationsHigher cost, longer production timeBaculovirus expression vectors
Mammalian cellsMost authentic modificationsHighest cost, lower yieldsConsideration for specific research needs

Methodologically, optimizing E. coli expression requires careful selection of:

  • Bacterial strain (BL21(DE3), Rosetta, etc.)

  • Induction conditions (temperature, IPTG concentration)

  • Growth media composition

  • Cell lysis protocols

  • Purification strategies optimized for His-tagged proteins

When higher protein authenticity is required, researchers should consider transitioning to eukaryotic expression systems despite their increased cost and complexity.

How should I design experiments to study FPV132 protein interactions?

Designing robust experiments to study FPV132 protein interactions requires careful consideration of research objectives and appropriate methodologies . A comprehensive experimental design should include:

  • Hypothesis formulation:

    • Clearly define expected interaction partners based on known functions

    • Ensure research questions are testable and specific

  • Methodology selection:

    • In vitro methods: Pull-down assays, co-immunoprecipitation, surface plasmon resonance

    • Cellular methods: Proximity ligation assays, FRET, co-localization studies

    • Structural methods: X-ray crystallography or cryo-EM of complexes

  • Controls implementation:

    • Positive controls (known interactions)

    • Negative controls (non-interacting proteins)

    • Technical replicates (minimum three)

    • Biological replicates (different preparations)

  • Validation strategy:

    • Multiple orthogonal methods to confirm interactions

    • Functional relevance testing through mutagenesis

    • Competition assays to confirm specificity

This experimental design framework ensures that the evidence obtained directly addresses the research question as unambiguously as possible, aligning with fundamental principles of sound research design .

What purification strategies are most effective for recombinant His-tagged FPV132?

Based on available information about recombinant FPV132 with an N-terminal His tag , researchers should implement a multi-step purification strategy:

Purification StepMethodologyKey ParametersQuality Control
Immobilized Metal Affinity Chromatography (IMAC)Ni-NTA or Co-NTA resinImidazole gradient optimizationSDS-PAGE, Western blot
Size Exclusion ChromatographySuperdex or Sephacryl columnsBuffer composition, flow rateDynamic light scattering
Ion Exchange Chromatography (optional)Q or SP columns based on pISalt gradient optimizationActivity assays

Methodologically, researchers should:

  • Optimize IMAC binding and elution conditions to minimize co-purification of contaminating proteins

  • Monitor protein stability throughout purification using activity assays or thermal shift assays

  • Implement quality control at each step including purity assessment and aggregation analysis

  • Evaluate final preparation using mass spectrometry to confirm identity and integrity

This systematic approach ensures high-quality FPV132 preparations suitable for downstream structural and functional studies.

How can I verify the proper folding and activity of purified FPV132?

Verifying proper folding and activity of recombinant FPV132 is crucial for ensuring experimental reliability. Researchers should implement a comprehensive quality assessment strategy:

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • Differential scanning fluorimetry to evaluate thermal stability

    • Size exclusion chromatography-multi-angle light scattering (SEC-MALS) to confirm molecular weight and homogeneity

  • Functional verification:

    • Binding assays with predicted interaction partners

    • Activity assays based on predicted biochemical function

    • Comparisons with native protein where available

  • Structural integrity assessment:

    • Limited proteolysis to identify well-folded domains

    • NMR spectroscopy for solution structure assessment

    • Crystallization trials as ultimate verification of structural integrity

These methodological approaches provide critical validation that purified FPV132 maintains its native characteristics and functionality for downstream applications.

How can FPV132 be utilized in recombinant vaccine development strategies?

While specific information about FPV132's role in vaccine development is not detailed in the search results, the use of recombinant fowlpox virus as a vaccine vector platform is well established . Researchers exploring FPV132's potential in vaccine development should consider:

  • Vector design considerations:

    • FPV132 modification or deletion effects on vector properties

    • Integration with heterologous antigens (similar to the gB integration approach described for ILTV vaccines)

    • Promoter selection for optimal FPV132 or antigen expression

  • Immunological assessment methodology:

    • T-cell response evaluation (ELISpot, intracellular cytokine staining)

    • Antibody response measurement (ELISA, neutralization assays)

    • Cytokine profiling to characterize immune polarization

  • Comparative vaccine platform evaluation:

    • FPV132-modified vectors versus conventional recombinant fowlpox vectors

    • Prime-boost strategies incorporating FPV132-based constructs

    • Cross-protection studies against heterologous challenges

A methodological example comes from the development of recombinant fowlpox virus expressing the gB gene from infectious laryngotracheitis virus , which demonstrates the general approach for engineering fowlpox-based vaccine vectors.

What role might FPV132 play in viral pathogenesis and host-pathogen interactions?

Understanding FPV132's potential role in viral pathogenesis requires consideration of the broader context of fowlpox virus genomics. The Fowlpox virus genome contains numerous genes involved in immune evasion and host adaptation, including natural killer cell receptors, chemokines, growth factors, and serine proteinase inhibitors .

Host Interaction CategoryExamples in Fowlpox GenomePotential FPV132 ConnectionsResearch Methodology
Immune evasionNK cell receptors, IL-18 binding proteinPotential modulation of host recognitionImmune cell interaction assays
Cell growth modulationEGF domain proteins, growth factorsPossible effects on cell cycle or apoptosisCell viability and proliferation studies
Tissue tropismAnkyrin repeat proteins, T10 homologueContribution to cell or tissue specificityInfection models in different cell types

Methodologically, researchers investigating FPV132's role should:

  • Develop gene knockout or silencing approaches to assess function in viral context

  • Implement comparative transcriptomics and proteomics in infected versus uninfected cells

  • Establish relevant in vitro and ex vivo infection models

  • Consider structural studies to identify potential interaction surfaces with host factors

How can structural studies of FPV132 inform antiviral drug development?

Structural characterization of viral proteins like FPV132 provides essential foundations for structure-based drug design. Although specific structural information for FPV132 is not provided in the search results, fowlpox virus proteins represent potential targets for antiviral development, particularly for avian diseases .

A methodological framework for FPV132 structure-based drug discovery would include:

  • Structural determination strategy:

    • X-ray crystallography of purified recombinant FPV132

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic regions

    • Homology modeling based on L5 homologs if experimental structures are challenging

  • Structure-based virtual screening:

    • Identification of druggable pockets or active sites

    • Molecular docking of compound libraries

    • Pharmacophore modeling based on structural features

    • Fragment-based approaches for initial hits

  • Experimental validation methodology:

    • Binding assays (thermal shift, surface plasmon resonance)

    • Functional inhibition assays

    • Structural confirmation of binding (co-crystallization)

    • Cell-based viral inhibition assays

These approaches could identify molecules that specifically target FPV132 functions, potentially leading to antivirals for fowlpox or related poxvirus infections.

How do I address expression and purification challenges with recombinant FPV132?

Researchers working with recombinant FPV132 may encounter various expression and purification challenges. Based on the protein's characteristics (129 amino acids, His-tagged) , the following methodological troubleshooting approaches are recommended:

  • Low expression yield troubleshooting:

    • Optimize codon usage for E. coli

    • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

    • Vary induction conditions (temperature 16-30°C, IPTG concentration 0.1-1mM)

    • Consider fusion partners to enhance solubility (MBP, SUMO, GST)

  • Protein solubility improvement:

    • Screen buffer conditions (pH 6.0-8.0, NaCl 100-500mM)

    • Add solubility enhancers (glycerol 5-10%, mild detergents)

    • Test refolding protocols if inclusion bodies form

    • Consider on-column refolding during purification

  • Purification optimization:

    • Implement step gradients for IMAC elution

    • Add imidazole (5-10mM) to binding buffer to reduce non-specific binding

    • Include protease inhibitors throughout purification

    • Consider tag removal if it interferes with function

  • Storage stability enhancement:

    • Screen buffer additives (glycerol, reducing agents)

    • Determine optimal protein concentration for storage

    • Evaluate freeze-thaw stability versus flash-freezing aliquots

    • Consider lyophilization for long-term storage

These methodological approaches address common challenges in recombinant protein work and should be systematically tested to optimize FPV132 production.

What statistical methods are most appropriate for analyzing FPV132 interaction data?

The appropriate statistical methods for analyzing protein interaction data depend on the experimental approach and data characteristics. For FPV132 interaction studies, researchers should consider:

Data TypeAppropriate Statistical MethodsImplementation ConsiderationsSignificance Assessment
Binary interaction dataFisher's exact test, Chi-squareContingency table analysisp-value < 0.05, odds ratios
Quantitative binding datat-tests, ANOVA, regression analysisTest assumptions of normalityp-value with multiple testing correction
High-throughput screeningZ-score, robust Z-scoreQuality control metricsFalse discovery rate control
Network analysisDegree distribution, clustering coefficientsRandomization controlsEmpirical p-values

Methodologically, researchers should:

  • Establish clear criteria for positive versus negative interactions before analysis

  • Include appropriate positive and negative controls in each experiment

  • Perform power analysis to determine required sample sizes

  • Implement appropriate multiple testing corrections for large-scale studies

  • Consider data visualization methods (interaction networks, heat maps) to complement statistical analysis

What emerging technologies could advance FPV132 research?

Several cutting-edge technologies hold promise for advancing FPV132 research beyond current capabilities:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for in situ structural studies

    • Integrative structural biology combining multiple data types

    • Time-resolved structural methods for capturing dynamic states

    • AlphaFold2 and other AI-based structure prediction tools

  • Next-generation interaction proteomics:

    • Proximity labeling methods (BioID, APEX) for in vivo interaction mapping

    • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

    • Single-molecule imaging of interactions in living cells

    • Crosslinking mass spectrometry for structural constraints

  • Advanced functional genomics:

    • CRISPR-based functional screens for host factors

    • Base editing for precise mutagenesis

    • Single-cell transcriptomics of infected populations

    • Synthetic viral genomes for systematic functional studies

These emerging technologies could provide unprecedented insights into FPV132 structure, function, and interactions within the context of viral infection.

How might comparative studies across poxvirus homologs inform our understanding of FPV132?

The Fowlpox virus genome has significant genomic differences compared to other chordopoxviruses, being substantially larger (260-309 kbp versus 178-191 kbp) . Comparative studies across L5 homologs from different poxviruses could reveal important evolutionary and functional insights:

Research ApproachMethodological ImplementationExpected OutcomesResearch Impact
Sequence-based phylogeneticsMultiple sequence alignment, evolutionary rate analysisIdentification of conserved vs. variable regionsUnderstanding functional constraints
Structural comparisonsSuperposition of experimental or predicted structuresConservation of binding interfacesInsight into functional mechanisms
Cross-complementation studiesGene replacement in viral backgroundsFunctional interchangeability assessmentIdentification of species-specific functions
Host range determinationInfection studies with modified virusesSpecies-specific adaptation mechanismsUnderstanding viral host specificity

These comparative approaches can reveal both fundamental functions conserved across poxvirus L5 homologs and specialized adaptations in FPV132 that may relate to fowlpox virus's avian host specificity.

What roles might FPV132 play in viral replication and morphogenesis?

Understanding FPV132's potential roles in viral replication and morphogenesis requires consideration of the fowlpox virus life cycle. While specific functions of FPV132 are not detailed in the search results, its characterization as an L5 homolog suggests potential roles in virion assembly or structure.

Methodologically, researchers investigating these functions should consider:

  • Localization studies:

    • Immunofluorescence microscopy during different stages of infection

    • Subcellular fractionation and Western blotting

    • Electron microscopy with immunogold labeling

  • Interaction mapping:

    • Identification of viral protein partners during assembly

    • Host factor interactions during morphogenesis

    • Temporal mapping of interaction networks

  • Functional perturbation:

    • Temperature-sensitive mutants for conditional phenotypes

    • Inducible expression systems for temporal control

    • Dominant-negative approaches if direct knockouts are challenging

  • Structural contribution assessment:

    • Analysis of FPV132 incorporation into mature virions

    • Cryo-electron microscopy of intact viral particles

    • Assessment of virion stability with FPV132 modifications

These methodological approaches could reveal FPV132's specific contributions to the complex process of fowlpox virus replication and assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.