Recombinant Fowlpox virus Protein J5 homolog (FPV136)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FPV136; F11; Protein J5 homolog; FPV136
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV136
Target Protein Sequence
MDNVINDEAIFKYCESNPKDRDCLCIHPEPTIEKIGEDLLLPYYCWYEPCKRKTAKIPTA LRDNMKRCNLIDCSVSLGEINLLDGILKVNNDCLSSHAIYAGYSVKPLEQEIHLPIIDPK YLILGLAILALIVLINW
Uniprot No.

Target Background

Function

Envelope protein component of the entry-fusion complex. It facilitates viral membrane fusion with the host cell membrane during viral entry and plays a role in cell-cell fusion (syncytium formation).

Database Links

KEGG: vg:1486684

Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the genomic location and structure of FPV136?

FPV136 is located within the 288-kbp FPV genome, which consists of a central coding region bounded by identical 9.5-kbp inverted terminal repeats . Like other poxvirus proteins, FPV136 is encoded within the genome region containing genes involved in virion structure and protein processing. Researchers should note that the FPV genome organization, while exhibiting colinearity with other chordopoxviruses, is interrupted by translocation and a major inversion that may affect protein function and expression .

Methodological approach: To accurately identify and characterize the FPV136 gene, researchers should perform comparative genomic analysis using bioinformatics tools such as BLAST alignment against other poxvirus genomes. Sequence analysis software like Phred and Phrap can be used for assembly, while Consed sequence editor allows for manual editing of consensus sequences . For identifying promoter regions, researchers should generate a scoring matrix using PROFILEMAKE based on known vaccinia virus early-promoter consensus sequences.

How can FPV136 be expressed in experimental systems?

Expression of FPV136 requires selection of an appropriate vector system based on research objectives. For vaccine development purposes, recombinant fowlpox virus vectors have proven effective for co-expression of target proteins and immunostimulatory molecules.

Methodological approach: Researchers should consider a construction strategy similar to that used for other FPV recombinants. For example, when generating novel FPV recombinants:

  • Culture chicken embryo fibroblast (CEF) cells and infect them with parent FPV strain

  • Transfect infected cells with a transfer vector containing the FPV136 gene

  • Allow for homologous recombination to occur during incubation

  • Apply selective pressure (e.g., MXH solution containing mycophenolic acid, xanthine, and hypoxanthine)

  • Harvest virus by freeze/thawing cycles and plaque purification under selection

The verification of recombinant virus can be performed using PCR amplification with specific primers, similar to the approach used for IL-18 insertion verification in fpIBD1 recombinants .

What purification methods are recommended for recombinant FPV136 protein?

Purification of FPV136 requires a multi-step approach to ensure protein integrity and purity for downstream applications.

Methodological approach: Researchers should implement a purification strategy that includes:

  • Initial clarification of infected cell lysates through centrifugation

  • Affinity chromatography using epitope tags (His, FLAG, or GST) strategically added to FPV136

  • Size-exclusion chromatography to separate monomeric from aggregated protein

  • Ion-exchange chromatography for removing contaminants with different charge properties

  • Protein concentration determination using Bradford or BCA assays

  • Purity assessment by SDS-PAGE with Coomassie or silver staining

For vaccine development applications, researchers should ensure that purification methods maintain the native conformation of epitopes to preserve immunogenicity.

How can researchers verify the expression of recombinant FPV136?

Verification of proper expression is critical before proceeding with functional or structural studies.

Methodological approach: Expression verification should follow a multi-technique approach:

  • Western blot analysis using antibodies specific to FPV136 or to added epitope tags

  • Immunofluorescence microscopy to confirm cellular localization

  • Mass spectrometry for protein identification and post-translational modification analysis

  • RT-PCR to confirm transcription using primers designed from the FPV136 sequence

  • Functional assays to verify biological activity

Similar verification approaches have been used for fpIBD1::IL-18 recombinants where PCR amplifications were set up using specific primers to confirm successful insertion .

What approaches can be used to study FPV136 interactions with host proteins?

Understanding protein-protein interactions is essential for elucidating the function of FPV136 in viral pathogenesis and host immune evasion.

Methodological approach: Researchers should employ complementary techniques for comprehensive interaction mapping:

  • Yeast two-hybrid screening against avian cDNA libraries

  • Co-immunoprecipitation followed by mass spectrometry (IP-MS)

  • Proximity-based labeling (BioID or APEX) to identify proteins in close proximity to FPV136 in infected cells

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for kinetic analysis of direct interactions

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualization of interactions in living cells

When interpreting interaction data, researchers should consider the context of FPV infection, as the presence of other viral proteins may influence interaction networks. The extensive genome colinearity interrupted by translocation and inversion in FPV suggests potentially unique protein-protein interaction landscapes compared to other poxviruses .

How does the inclusion of FPV136 in recombinant vaccines affect immunogenicity?

The effectiveness of recombinant fowlpox virus vaccines depends on proper antigen presentation and immune stimulation.

Methodological approach: To evaluate FPV136 contribution to vaccine efficacy, researchers should:

  • Design recombinant FPV constructs with and without FPV136

  • Consider co-expression with immune-enhancing cytokines (e.g., chicken interferon-γ or interleukin-18)

  • Evaluate antibody responses using ELISA at regular intervals post-vaccination

  • Assess T-cell responses by measuring CD4+ and CD8+ T-lymphocyte numbers in peripheral blood

  • Conduct challenge studies to determine protection levels against relevant pathogens

  • Compare morbidity, virus shedding, and histopathological changes between vaccinated and control groups

This approach mirrors the methodology used to evaluate rFPV-IFNγS1 efficacy against heterotypic IBV strains, which showed significant differences in T-lymphocyte numbers between vaccinated and control groups .

What structural biology techniques can elucidate FPV136 conformation?

Understanding the three-dimensional structure of FPV136 is crucial for functional characterization and rational design of vaccines or antivirals.

Methodological approach: Researchers should pursue complementary structural biology techniques:

  • X-ray crystallography:

    • Express and purify milligram quantities of FPV136

    • Screen crystallization conditions systematically

    • Collect diffraction data at synchrotron radiation facilities

    • Solve structure using molecular replacement or experimental phasing methods

  • Cryo-electron microscopy:

    • Prepare purified FPV136 on grids for single-particle analysis

    • Collect data using high-end electron microscopes with direct electron detectors

    • Process images and reconstruct 3D structure

  • NMR spectroscopy for dynamics studies:

    • Isotopically label FPV136 with 15N and 13C

    • Collect multi-dimensional spectra

    • Assign resonances and calculate solution structure

  • Computational approaches:

    • Homology modeling based on related J5 homologs

    • Molecular dynamics simulations to predict conformational changes

    • Protein-protein docking with predicted interaction partners

How can researchers investigate the role of FPV136 in viral pathogenesis?

Understanding FPV136's contribution to viral pathogenesis requires comprehensive functional studies in relevant model systems.

Methodological approach:

  • Generate FPV136 knockout mutants using recombination techniques

  • Perform comparative infection studies using wild-type and mutant viruses

  • Assess viral replication kinetics through growth curves in avian cell cultures

  • Evaluate transcriptome changes in infected cells using RNA-seq

  • Conduct in vivo studies in chickens to determine virulence attenuation

  • Perform histopathological analysis of infected tissues

  • Measure viral load in different organs using quantitative PCR

When analyzing pathogenesis data, researchers should consider the larger context of FPV's gene complement, which includes numerous homologs of genes encoding proteins involved in steroid biogenesis, antioxidant functions, vesicle trafficking, and other cellular processes that may affect host cell function .

What technologies can address challenges in expressing difficult regions of FPV136?

Some viral proteins contain regions that are challenging to express due to hydrophobicity, toxicity, or complex folding requirements.

Methodological approach: Researchers should consider specialized expression strategies:

  • For hydrophobic domains:

    • Use fusion partners (MBP, GST, NusA) to enhance solubility

    • Express as split constructs covering non-hydrophobic regions

    • Employ membrane-mimetic systems (detergents, nanodiscs, liposomes)

  • For proteins affecting host cell viability:

    • Utilize inducible expression systems with tight regulation

    • Express in cell-free translation systems

    • Use specialized host strains with enhanced tolerance

  • For disulfide-rich domains:

    • Direct expression to oxidizing compartments (periplasm in bacteria)

    • Use eukaryotic expression systems with proper folding machinery

    • Co-express with appropriate chaperones and disulfide isomerases

Table 1. Comparison of expression systems for recombinant FPV136 production.

Expression SystemAdvantagesLimitationsYield PotentialPost-translational Modifications
E. coliRapid growth, simple genetics, cost-effectiveLimited PTMs, inclusion body formationHighMinimal
Baculovirus/Insect CellsEukaryotic PTMs, high expressionHigher cost, longer production timeMedium-HighGood
Mammalian CellsAuthentic folding, full PTMsHighest cost, complex mediaLow-MediumExcellent
Avian Cell LinesNative environment for FPV proteinsLimited genetic tools, slower growthMediumNative to viral host
Cell-Free SystemsRapid, amenable to toxic proteinsExpensive, limited scaleLowMinimal

How should researchers design experiments to compare FPV136 function across different strains?

Comparative analysis of FPV136 variants can provide insights into host adaptation and virulence determinants.

Methodological approach:

  • Sequence multiple FPV strains to identify natural variants of FPV136

  • Generate a phylogenetic tree to establish evolutionary relationships

  • Select representative variants spanning the evolutionary diversity

  • Clone and express each variant using identical expression systems

  • Conduct standardized functional assays to compare activity

  • Perform complementation studies in FPV136-knockout backgrounds

  • Correlate functional differences with sequence variations and virulence phenotypes

What controls are essential for experimental validation of FPV136 function?

Rigorous controls are critical for accurate interpretation of functional studies.

Methodological approach: Researchers should implement the following controls:

  • Positive controls:

    • Well-characterized J5 homologs from related viruses

    • Purified native FPV136 (if available)

    • Cellular proteins with similar function

  • Negative controls:

    • Catalytically inactive mutants (site-directed mutagenesis)

    • Structurally similar but functionally distinct proteins

    • Empty vector controls for expression studies

  • Specificity controls:

    • Dose-response relationships

    • Competition assays with unlabeled ligands

    • Antibody blocking experiments

  • Technical controls:

    • Multiple biological and technical replicates

    • Randomization and blinding where applicable

    • Cross-validation using orthogonal techniques

Similar control approaches were used in evaluating fpIBD1 efficacy, where unvaccinated challenged groups served as controls for vaccinated challenged groups .

How can researchers optimize antigen delivery of FPV136 in vaccine development?

Developing effective recombinant vaccines requires optimization of antigen delivery to maximize immune responses.

Methodological approach:

  • Evaluate different FPV promoters to control expression timing and level

  • Test various subcellular targeting signals (secretion, surface display)

  • Co-express with immunomodulatory molecules:

    • Chicken cytokines (IFN-γ, IL-18) to enhance cellular immunity

    • Molecular adjuvants to shape immune response quality

  • Compare administration routes (wing-web puncture, intranasal, intramuscular)

  • Develop prime-boost strategies using heterologous vectors

  • Optimize dose and boosting interval

Research has shown that recombinant fowlpox viruses co-expressing viral antigens with chicken cytokines can induce strong immune responses, as demonstrated with rFPV-IFNγS1, which protected chickens against challenge with homotypic and some heterotypic IBV strains .

What approaches can resolve contradictory data about FPV136 function?

Scientific research occasionally produces contradictory results that must be systematically resolved.

Methodological approach:

  • Replicate original experiments with identical conditions

  • Systematically vary experimental parameters to identify conditional factors

  • Employ orthogonal techniques to validate findings

  • Consider strain-specific or cell type-specific effects

  • Evaluate time-dependent phenomena through detailed kinetic studies

  • Collaborate with original authors to compare protocols and materials

  • Perform meta-analysis of multiple studies

When investigating contradictions, researchers should consider the complex nature of poxvirus genomes and the potential for contextual effects from other viral genes, as FPV contains diverse gene complements with likely host range functions .

How should researchers analyze complex datasets from FPV136 functional studies?

Modern protein characterization generates complex multi-dimensional datasets requiring sophisticated analysis approaches.

Methodological approach:

  • For high-throughput interaction data:

    • Apply appropriate statistical models for interaction scoring

    • Use clustering algorithms to identify functional complexes

    • Perform network analysis to identify central nodes and modules

    • Integrate with public protein interaction databases

  • For conformational dynamics data:

    • Apply principal component analysis to identify major motion modes

    • Use time-series analysis for transitions between states

    • Correlate dynamic changes with functional outcomes

  • For immunological data:

    • Perform multivariate analysis to correlate immune parameters with protection

    • Use machine learning algorithms to identify predictive biomarkers

    • Apply systems biology approaches to model immune response networks

Table 2. Statistical approaches for different experimental data types in FPV136 research.

Data TypeRecommended Statistical ApproachesVisualization MethodsSoftware Tools
Protein Expression LevelsANOVA, t-tests, non-parametric testsBar charts, box plotsGraphPad Prism, R
Binding KineticsNon-linear regression, Scatchard analysisBinding curves, Scatchard plotsBIAevaluation, KaleidaGraph
Structural DataRMSD, RMSF, clustering algorithms3D structures, distance mapsPyMOL, UCSF Chimera
Immunological ResponsesMixed-effects models, survival analysisKaplan-Meier plots, heatmapsR (survival package), FlowJo
RNA-seq/TranscriptomicsDESeq2, edgeR, GSEAVolcano plots, enrichment mapsR/Bioconductor, GSEA software

What bioinformatic approaches help predict FPV136 function in the absence of experimental data?

Computational approaches can guide experimental design when direct data is limited.

Methodological approach:

  • Homology-based function prediction:

    • Identify homologs in other poxviruses and cellular organisms

    • Perform phylogenetic analysis to identify conserved domains

    • Use HHpred or similar sensitive sequence comparison tools

  • Structural prediction and analysis:

    • Generate 3D models using AlphaFold2 or RoseTTAFold

    • Identify potential binding pockets and active sites

    • Perform in silico ligand docking to predict binding partners

  • Genomic context analysis:

    • Examine genomic neighborhood for functionally related genes

    • Identify co-expression patterns across infection time course

    • Look for conserved operonic structures across poxvirus species

Researchers should note that comparative genomic analysis of FPV with other chordopoxviruses has revealed extensive genome colinearity which is interrupted in FPV by a translocation and a major inversion , which may provide context for FPV136 function.

How can FPV136 knowledge improve recombinant fowlpox virus vaccines?

Understanding FPV136 structure and function can enhance vaccine design strategies.

Methodological approach:

  • Incorporate FPV136 modifications that:

    • Enhance stability in vaccine formulations

    • Improve immunogenicity of co-expressed antigens

    • Optimize viral replication in production systems

  • Develop rational attenuation strategies:

    • Engineer conditional mutations in FPV136

    • Design compensatory modifications that maintain manufacturing yield

    • Create temperature-sensitive variants for controlled replication

  • Enhance vector performance:

    • Modify FPV136 to extend transgene expression duration

    • Engineer tissue-specific activity for targeted immunization

    • Optimize for reduced pre-existing immunity interference

The rational design of safer and more effective FPV vaccines requires complete information on viral genes associated with virulence and host range, and understanding how these genes function in viral pathogenesis, immune evasion, and avian host range .

What diagnostic applications could utilize FPV136-specific detection?

Specific detection of FPV136 can have diagnostic applications in veterinary medicine and research.

Methodological approach:

  • Develop antibody-based detection methods:

    • Generate monoclonal antibodies against conserved FPV136 epitopes

    • Design ELISA protocols for detecting FPV136 in clinical samples

    • Develop immunohistochemistry procedures for tissue section analysis

  • Nucleic acid detection approaches:

    • Design PCR primers specific to conserved regions of FPV136

    • Develop quantitative PCR assays with appropriate controls

    • Create multiplex assays to simultaneously detect multiple viral targets

  • Rapid field detection systems:

    • Engineer lateral flow assays using FPV136-specific antibodies

    • Develop isothermal amplification methods for point-of-care testing

    • Create biosensor platforms for resource-limited settings

Similar PCR-based approaches have been used to detect IBDV in experimental studies, where RNA extraction from samples followed by real-time quantitative RT-PCR allowed sensitive viral detection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.