Recombinant Fowlpox virus Virion membrane protein A16 homolog (FPV181)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FPV181; Virion membrane protein A16 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-369
Protein Length
Full Length of Mature Protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV181
Target Protein Sequence
GQHVSNITVIATPQAPETKYLRVEYTGGYDDEYIRFFEAENIHSGDIGSEISPPFCLTRD
TTVKQCASFLSPEAKKKFVIVPGEPCKSLSFRPGSILDLQKIPYGTESYVLDGTRCRFIN
IDYLYTDPDIKRCCNKESDKDCPEIFSNNYETDHCDTIMSSICLQTPGSLPCREWLEKKR
EVAFDTYMKVCSDHLDANYCSDFVDYTRPDNFGYSDAAILSYCSKHRNNPNCWCVTTPKN
DKLFSLELALGPKVCWLHECTDKSKDRKYLLFDQDVQRTNCKYIGCNINVDTLRLRNSVA
ELIAKCGGSIAEDTVLGDDSYNKEAKLPSFFSIIPVCIVLLCLFVLFYFLRIYDAKVINS
NTINVYRK
Uniprot No.
Target Background
Function
This envelope protein is part of the entry-fusion complex. It mediates viral membrane fusion with the host cell membrane during viral entry and plays a role in cell-cell fusion (syncytium formation).
Database Links
KEGG: vg:1486753
Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
