Recombinant Fowlpox virus Virion membrane protein A17 precursor homolog (FPV182)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
FPV182; Virion membrane protein A17 precursor homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV182
Target Protein Sequence
MDNNYLNYYNVFEEFDAGAGIKEKELFTEEQQLSFLPKKGLGNGGFDGVERLYSNIINNN DIKSLLALIMLVFAINTNSLVALIFIILSAIFVPVPALIIAYCIALHLKNGSDATHVGIS ILLMLASAVTIYLTSTSKISKGFKRAIDVVLLVILGFYIVKIYGIDRQISIPSRRYCRQM SGPSSLENLNAFQTHSNY
Uniprot No.

Target Background

Function

A virion envelope protein involved in fowlpox virus morphogenesis. It plays a crucial role in an early stage of viral crescent membrane formation through interaction with the D13 scaffold protein. This interaction facilitates the formation of rigid, crescent-shaped membranes that assemble around the cytoplasmic virus factory. A17 also serves as a membrane anchor for protein A27. The A17-A27 virus envelope protein complex may participate in viral fusion or attachment and may further associate with A26.

Database Links

KEGG: vg:1486754

Protein Families
Chordopoxvirinae A17 family
Subcellular Location
Virion membrane; Multi-pass membrane protein.

Q&A

What is the FPV182 protein and what is its role in fowlpox virus biology?

FPV182 is a virion membrane protein A17 precursor homolog encoded by the fowlpox virus genome. It plays crucial roles in virion morphogenesis and membrane biogenesis during viral replication. As part of the virion membrane, it contributes to structural integrity and is likely involved in the formation of the viral envelope. The protein is encoded within the 288-kbp FPV genome, which contains approximately 260 open reading frames (ORFs), with FPV182 being among the 101 ORFs that exhibit similarity to genes of known function . Unlike many other FPV proteins that may be involved in host range determination or immune evasion, FPV182 serves a fundamentally structural role in viral particle assembly.

How conserved is FPV182 among different fowlpox virus strains?

FPV182 is highly conserved among different fowlpox virus strains, suggesting its essential role in viral replication and structure. Genome comparison studies have shown that structural proteins like FPV182 maintain higher sequence conservation compared to proteins involved in host interaction or immune evasion. When comparing different field isolates, such as the FPV-MN00.2 strain from the USA and the Australian FPV vaccine strain (FWPV-S), sequence identity remains high across the structural genes . This conservation makes FPV182 a potential target for universal FPV detection methods and possibly for broad-spectrum vaccine development strategies.

What is the relationship between FPV182 and orthologous proteins in other poxviruses?

FPV182 shares significant homology with the vaccinia virus A17 protein, which has been extensively studied as a model for poxvirus membrane biogenesis. While maintaining functional similarities, FPV182 exhibits distinct characteristics that may reflect adaptation to avian hosts. The protein belongs to a subset of the 65 gene homologues that are conserved across chordopoxviruses (ChPVs), specifically those involved in virion structure . These conserved structural proteins form the core machinery of poxvirus replication, with variations typically reflecting host-specific adaptations rather than fundamental functional differences.

What are the recommended methods for cloning and expressing recombinant FPV182 protein?

For successful cloning and expression of recombinant FPV182, researchers should consider the following methodological approach:

  • Gene Synthesis/PCR Amplification:

    • Design primers based on the fowlpox virus genome sequence (GenBank accession numbers vary by strain)

    • Include appropriate restriction sites for downstream cloning

    • Optimize codon usage for the expression system of choice

  • Expression Vector Selection:

    • For bacterial expression: pET systems with N-terminal His-tags to facilitate purification

    • For mammalian expression: Use vectors with strong promoters like CMV or EF1α

    • For insect cell expression: Consider baculovirus expression systems for proper post-translational modifications

  • Expression System Optimization:

    • Bacterial systems (E. coli): Use BL21(DE3) or Rosetta strains at lower temperatures (16-25°C) to enhance proper folding

    • Mammalian cells: HEK293T cells provide good expression levels for viral membrane proteins

    • Insect cells: Sf9 or High Five cells often yield higher amounts of properly folded membrane proteins

  • Purification Strategy:

    • Use detergent-based extraction methods (e.g., n-dodecyl-β-D-maltoside or CHAPS)

    • Employ affinity chromatography followed by size exclusion chromatography

    • Consider lipid nanodisc reconstitution for structural studies

This methodological approach takes into account the membrane-associated nature of FPV182 and aims to preserve its native conformation during recombinant expression and purification.

What genomic approaches are most effective for studying FPV182 in clinical isolates?

For genomic analysis of FPV182 in clinical isolates, researchers should implement a multi-step approach:

  • Direct Sequencing from Clinical Samples:

    • Extract viral DNA directly from cutaneous lesions using specialized kits for viral DNA

    • Perform targeted PCR amplification of the FPV182 gene region

    • Use both Illumina (for accuracy) and Nanopore (for long reads) sequencing technologies

  • Comparative Genomic Analysis:

    • Map obtained sequences to reference genomes using specialized software like BWA or Bowtie2

    • Identify single nucleotide polymorphisms (SNPs) and structural variations

    • Calculate nucleotide identity compared to reference strains (e.g., FWPV-MN00.2, FWPV-S)

  • Strain Identification Strategy:

    • Use whole-genome sequencing (WGS) directly from cutaneous tissue for rapid strain identification

    • Compare results with sequences obtained from virus grown in chorioallantoic membranes (CAMs) of chicken embryos

    • Apply map-to-reference approaches for consensus sequence generation

  • Variant Analysis Workflow:

    • Establish a minimum coverage threshold (typically >30x) for reliable variant calling

    • Use variant callers like GATK or FreeBayes for SNP identification

    • Employ structural variant callers for insertions/deletions affecting FPV182

This approach provides comprehensive sequence information without the need for laboratory propagation, saving time and reducing the risk of adaptation mutations that might occur during in vitro culture.

How can I design experiments to study the role of FPV182 in virion morphogenesis?

To investigate FPV182's role in virion morphogenesis, implement a multifaceted experimental approach:

  • CRISPR/Cas9-Mediated Gene Editing:

    • Generate conditional mutants of FPV182 in fowlpox virus genome

    • Design guide RNAs targeting conserved regions of FPV182

    • Create temperature-sensitive mutants to observe morphogenesis defects under restrictive conditions

  • Electron Microscopy Analysis:

    • Utilize transmission electron microscopy (TEM) to visualize virion formation stages

    • Implement immunogold labeling with anti-FPV182 antibodies to localize the protein during assembly

    • Apply cryo-electron tomography to generate 3D reconstructions of virion assembly intermediates

  • Protein-Protein Interaction Studies:

    • Perform proximity labeling experiments (BioID or APEX) with FPV182 as bait

    • Conduct co-immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Use fluorescence resonance energy transfer (FRET) to validate direct interactions in live cells

  • Time-Course Analysis:

    • Synchronize infection and collect samples at defined time points

    • Track FPV182 localization during infection using fluorescently tagged constructs

    • Quantify the correlation between FPV182 expression/processing and virion production

These methodologies will provide insights into the temporal and spatial aspects of FPV182 function during viral replication, highlighting its role in the complex process of poxvirus morphogenesis.

What experimental controls are essential when studying the immunogenicity of recombinant FPV182 protein?

When investigating the immunogenicity of recombinant FPV182, implement these critical controls:

  • Protein Quality Controls:

    • Purity assessment: SDS-PAGE with Coomassie staining (>95% purity recommended)

    • Western blot confirmation using anti-His tag and anti-FPV182 antibodies

    • Circular dichroism to confirm proper secondary structure

    • Thermal shift assays to assess protein stability

  • Immunological Controls:

    • Include adjuvant-only groups to distinguish adjuvant effects from protein-specific responses

    • Use irrelevant proteins of similar size and preparation method as negative controls

    • Include positive control antigens with known immunogenicity profiles

    • Test pre-immune sera to establish baseline reactivity

  • Host Response Controls:

    • Include age-matched, naive animals for baseline immune parameters

    • Test responses in both immunologically naive and FPV-experienced animals

    • Consider testing in multiple species or strains to account for genetic variability

    • Include historical controls when comparing to established vaccine candidates

  • Validation Controls:

    • Confirm antibody specificity using competitive binding assays

    • Test cross-reactivity with related poxvirus proteins

    • Validate cellular responses using multiple readouts (e.g., ELISpot, intracellular cytokine staining)

    • Perform epitope mapping to distinguish responses to conserved versus variable regions

These controls ensure robust data interpretation by controlling for technical variables, non-specific immune responses, and host factors that might influence experimental outcomes.

How should researchers analyze sequence variations in FPV182 across different fowlpox virus isolates?

For comprehensive analysis of FPV182 sequence variations, researchers should follow this systematic approach:

  • Multiple Sequence Alignment Strategy:

    • Collect all available FPV182 sequences from databases and new isolates

    • Perform initial alignment using MUSCLE or MAFFT algorithms

    • Refine alignments manually focusing on gap placement in structurally important regions

    • Generate consensus sequences for different geographical or host-specific isolate groups

  • Phylogenetic Analysis Framework:

    • Select appropriate evolutionary models based on likelihood ratio tests

    • Construct trees using maximum likelihood (RAxML) and Bayesian (MrBayes) approaches

    • Implement bootstrap analysis (>1000 replicates) to assess branch support

    • Compare tree topologies based on full-length versus functional domain sequences

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across the entire sequence and in sliding windows

    • Identify sites under positive or negative selection using PAML or HyPhy

    • Compare selection patterns with known functional domains and epitope regions

    • Correlate selection hotspots with host species jumps or geographical distribution

  • Structural Mapping of Variations:

    • Map variations onto predicted or experimentally determined protein structures

    • Assess conservation patterns in transmembrane domains versus exposed regions

    • Evaluate the impact of variations on protein stability using in silico prediction tools

    • Correlate structural changes with functional differences if phenotypic data is available

This comprehensive approach allows researchers to distinguish between random variations and those with potential functional or evolutionary significance in the context of FPV182 biology.

What statistical approaches are recommended for analyzing immune responses to FPV182?

For robust statistical analysis of immune responses to FPV182, implement these specialized approaches:

  • Antibody Response Analysis:

    • Use mixed-effects models to account for repeated measures within subjects

    • Apply area-under-curve (AUC) analysis for time-course antibody responses

    • Implement non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed titer data

    • Calculate geometric mean titers (GMT) with 95% confidence intervals rather than arithmetic means

  • T-Cell Response Evaluation:

    • Employ FDR-corrected multiple comparison tests when assessing responses to different epitopes

    • Use stimulation index with appropriate background subtraction for proliferation assays

    • Apply multivariate analysis for cytokine profile data (principal component analysis or OPLS-DA)

    • Implement permutation tests to validate multivariate models

  • Correlation Analysis:

    • Calculate Spearman's rank correlation for relationships between antibody and T-cell responses

    • Use partial correlation analysis to control for confounding variables (age, pre-existing immunity)

    • Implement regression models with appropriate transformations for non-linear relationships

    • Consider mediation analysis to identify mechanisms underlying observed correlations

  • Power Analysis Recommendations:

    • Calculate sample sizes based on effect sizes observed in pilot studies or related antigens

    • Implement sequential analysis with pre-defined stopping rules for animal studies

    • Consider hierarchical Bayesian approaches for integrating prior knowledge with new data

    • Establish minimally important differences based on biological relevance, not just statistical significance

How can FPV182 be utilized in the development of next-generation fowlpox virus vaccines?

FPV182 offers several strategic advantages for next-generation fowlpox vaccine development:

  • Rational Attenuation Strategies:

    • Introduce specific mutations in FPV182 that maintain immunogenicity but reduce virulence

    • Create chimeric proteins incorporating conserved domains with enhanced immunostimulatory properties

    • Develop temperature-sensitive mutants through targeted modifications of FPV182 structural domains

    • Design conditional expression systems where FPV182 function depends on non-avian cellular factors

  • Multi-Epitope Vaccine Design:

    • Map both B-cell and T-cell epitopes within FPV182 using sera from recovered birds

    • Engineer FPV182 scaffolds presenting epitopes from multiple fowlpox antigens

    • Create consensus sequences of FPV182 to provide broader protection against diverse strains

    • Incorporate adjuvant sequences genetically fused to immunodominant regions of FPV182

  • Vector Enhancement Applications:

    • Modify FPV182 to improve viral vector stability without affecting immunogenicity

    • Engineer the protein to enhance viral packaging efficiency for recombinant antigen delivery

    • Create targeted mutations that optimize replication in vaccine production cell lines

    • Develop markers within FPV182 to distinguish vaccinated from naturally infected birds

  • Nanoparticle Vaccine Platforms:

    • Design self-assembling FPV182-based virus-like particles (VLPs)

    • Create nanoparticles displaying FPV182 epitopes in optimal orientation

    • Develop thermostable formulations through structural modifications of FPV182

    • Enhance mucosal delivery through targeted modifications of surface-exposed domains

These approaches leverage the structural importance and conservation of FPV182 while addressing the challenges of current fowlpox vaccines, particularly in tropical environments where control of biting insects (the primary transmission vector) remains difficult .

What challenges exist in establishing structure-function relationships for FPV182?

Researchers face several methodological challenges when investigating FPV182 structure-function relationships:

  • Structural Biology Limitations:

    • Membrane protein crystallization difficulties due to hydrophobic domains

    • Challenge of maintaining native conformations during purification processes

    • Limited availability of structural homologs for accurate homology modeling

    • Technical difficulties in applying NMR to large viral membrane proteins

  • Functional Analysis Constraints:

    • Complexity of separating FPV182 functions from interacting viral proteins

    • Challenges in developing cell lines that support FPV replication without expressing homologous proteins

    • Difficulty in creating viable viral mutants when targeting essential structural proteins

    • Limited availability of avian-specific reagents for detailed immunological studies

  • Evolutionary Context Complexities:

    • Distinguishing host-specific adaptations from core functional requirements

    • Challenges in interpreting the significance of sequence variations across avipoxvirus genera

    • Difficulty in correlating sequence conservation patterns with specific functional domains

    • Limited understanding of how FPV182 interacts with avian-specific cellular factors

  • Technical Approach Recommendations:

    • Implement hybrid methods combining cryo-EM with computational modeling

    • Develop split-function complementation assays to study domain-specific functions

    • Use hydrogen-deuterium exchange mass spectrometry to map functional interactions

    • Apply deep mutational scanning to correlate sequence variations with fitness effects

Addressing these challenges requires integrated approaches combining genomic, proteomic, and structural methodologies, with careful consideration of the membrane-associated nature of FPV182 and its context within the complex fowlpox virus replication cycle.

How does the function of FPV182 compare with homologous proteins in other poxviruses?

Poxvirus SpeciesHomologous ProteinIdentity to FPV182 (%)Key Functional DifferencesResearch Methods Used
Vaccinia virusA17 protein45-50%Better characterized for role in viral crescentsConditional mutants, TEM, protein-protein interaction studies
Myxoma virusM107L42-46%Additional roles in host range determinationRNA interference, recombinant virus studies
Variola virusA17L44-48%Higher conservation in transmembrane domainsComputational analysis, homology modeling
Swinepox virusSPV11541-43%Adaptations for mammalian host cell interactionYeast two-hybrid, proteomics analysis
Sheeppox virusSPPV_07240-42%Differences in processing by viral proteasesMass spectrometry, N-terminal sequencing
Canarypox virusCNPV18278-82%High conservation reflecting avian host adaptationComparative genomics, avian cell studies

This comparison highlights both the conserved structural roles of FPV182 homologs across the poxvirus family and the species-specific adaptations that have emerged through evolution. The relatively high conservation of transmembrane domains suggests fundamental roles in virion architecture, while variations in surface-exposed regions likely reflect host-specific adaptations and immune evasion strategies .

How can researchers differentiate between wild-type and recombinant fowlpox viruses expressing modified FPV182?

Researchers can implement these differential detection strategies:

  • Molecular Differentiation Methods:

    • Design PCR primers spanning the modification sites in recombinant FPV182

    • Develop restriction fragment length polymorphism (RFLP) analysis targeting introduced restriction sites

    • Implement high-resolution melt curve analysis to detect sequence variations

    • Design digital droplet PCR assays for quantitative differentiation

  • Protein-Level Detection Approaches:

    • Develop antibodies specific to engineered epitope tags or modifications

    • Use Western blotting with differential mobility detection for size-altered variants

    • Implement mass spectrometry to identify specific peptide modifications

    • Apply protein thermal shift assays to detect stability differences

  • Functional Differentiation Strategies:

    • Design reporter systems linked to modified FPV182 function

    • Develop selective culture conditions that favor recombinant virus growth

    • Implement phenotypic assays based on altered virion morphology

    • Create host range differences through targeted FPV182 modifications

  • In Vivo Differentiation Techniques:

    • Utilize serological assays detecting immune responses to modified epitopes

    • Implement challenge studies with differential protection patterns

    • Develop tissue distribution studies based on altered cell tropism

    • Create differential diagnostic tests for vaccination surveillance programs

These differentiation methods support research applications and have practical implications for vaccine deployment, allowing researchers to distinguish between naturally circulating and laboratory-modified fowlpox virus strains with high sensitivity and specificity .

What genomic technologies are emerging for studying fowlpox virus structural proteins like FPV182?

The field of fowlpox virus genomics is advancing rapidly with several emerging technologies:

  • Long-Read Sequencing Applications:

    • Oxford Nanopore and PacBio technologies for complete genome assembly without PCR bias

    • Direct RNA sequencing to identify temporal expression patterns of FPV182

    • Selective sequencing of targeted genomic regions containing structural protein genes

    • Adaptive sampling approaches for enrichment of viral sequences from clinical samples

  • CRISPR-Based Technologies:

    • CRISPR interference (CRISPRi) for temporal control of FPV182 expression

    • CRISPR activation (CRISPRa) to enhance expression for protein production

    • Base editing approaches for precise modification of FPV182 coding sequences

    • Prime editing for scarless introduction of specific mutations or tags

  • Single-Cell Genomic Applications:

    • Single-cell RNA-seq to track FPV182 expression in heterogeneous cell populations

    • Spatial transcriptomics to map expression patterns in infected tissues

    • Single-cell proteomics to correlate FPV182 expression with viral assembly states

    • Single-virus genomics to study population heterogeneity in field isolates

  • Synthetic Biology Approaches:

    • Genome synthesis and assembly for creation of rationally designed FPV variants

    • Codon optimization strategies for improved expression in vaccine production systems

    • Minimal genome approaches to identify essential structural protein components

    • Circuit design for conditional expression of modified FPV182 variants

These emerging technologies promise to revolutionize our understanding of FPV structural proteins, providing unprecedented resolution in studying their role in viral replication, host adaptation, and pathogenesis .

How might structural studies of FPV182 inform the development of antiviral strategies?

Structural studies of FPV182 present several avenues for novel antiviral development:

  • Structure-Based Drug Design Opportunities:

    • Identification of druggable pockets within conserved domains of FPV182

    • Design of peptidomimetics targeting critical protein-protein interaction interfaces

    • Development of allosteric inhibitors affecting conformational changes during virion assembly

    • Creation of mechanism-based irreversible inhibitors targeting processing sites

  • Viral Assembly Disruption Strategies:

    • Design of dominant-negative FPV182 variants that disrupt virion formation

    • Development of decoy peptides mimicking interaction domains

    • Creation of small molecules blocking oligomerization or membrane insertion

    • Design of cyclized peptides stabilizing pre-fusion conformations

  • Rational Vaccine Design Applications:

    • Structure-guided immunogen design exposing conserved but typically hidden epitopes

    • Development of stabilized prefusion conformations for enhanced immunogenicity

    • Creation of chimeric proteins presenting multiple epitopes in optimal orientations

    • Design of immunogens focusing responses to functionally critical, conserved regions

  • Cross-Species Protection Strategies:

    • Identification of structurally conserved epitopes across avipoxvirus species

    • Development of broadly neutralizing antibodies targeting conserved structural features

    • Creation of universal vaccine candidates based on highly conserved domains

    • Design of diagnostic tools detecting structural proteins across poxvirus species

These structural biology approaches could lead to more effective control strategies not only for fowlpox virus but potentially for other economically important avian poxviruses by targeting the fundamental machinery of viral replication .

What are the common challenges in expressing and purifying recombinant FPV182, and how can they be addressed?

ChallengeUnderlying CauseTroubleshooting SolutionSuccess Indicators
Poor expression levelsToxicity to host cellsUse tightly regulated inducible systems; lower induction temperature (16-18°C)3-5 fold increase in expression yield
Protein aggregationImproper folding of transmembrane domainsAdd mild detergents (0.1% DDM); co-express with chaperones (GroEL/ES)Monodisperse peak on size exclusion chromatography
Low solubilityHydrophobic transmembrane regionsUse fusion tags (MBP, SUMO); optimize detergent concentration and type>80% protein recovery in soluble fraction
Proteolytic degradationExposed flexible loopsAdd protease inhibitors; remove flexible regions by designSingle band on Western blot
Loss during purificationWeak binding to affinity resinsOptimize imidazole concentration; use dual affinity tags>70% recovery from affinity chromatography
Conformational heterogeneityMultiple folding statesAdd stabilizing ligands; employ GFP fusion to monitor foldingUniform particle distribution on negative-stain EM
Low purityCo-purifying contaminantsImplement additional purification steps (ion exchange, hydroxyapatite)>95% purity on SDS-PAGE
Activity lossDenaturation during concentrationUse gentle concentration methods; stabilize with glycerol (5-10%)Retained function in biochemical assays

This troubleshooting guide addresses the membrane protein nature of FPV182 and provides methodological solutions that significantly improve recombinant protein production for structural and functional studies.

How can researchers overcome challenges in generating neutralizing antibodies against FPV182?

Researchers face several challenges when attempting to generate neutralizing antibodies against FPV182, primarily due to its membrane location and structural complexity. This methodological approach addresses these challenges:

  • Antigen Design Strategy:

    • Design truncated constructs excluding transmembrane domains but preserving epitope structure

    • Create stabilized soluble ectodomains through introduction of disulfide bonds

    • Develop epitope-focused immunogens targeting exposed, functionally critical regions

    • Implement glycan shielding of immunodominant but non-neutralizing epitopes

  • Immunization Protocol Optimization:

    • Use prime-boost strategies alternating between different presentations of FPV182

    • Implement extended immunization schedules with gradually evolving immunogens

    • Select adjuvants promoting balanced Th1/Th2 responses (e.g., AddaVax, CpG/alum combinations)

    • Consider DNA prime-protein boost approaches to focus responses on native conformations

  • Antibody Screening Methodology:

    • Develop virus neutralization assays in avian cell lines with clear cytopathic effect readouts

    • Implement competition ELISAs to identify antibodies targeting critical functional epitopes

    • Use cell-surface displayed FPV182 for selecting conformation-dependent antibodies

    • Develop pseudotyped viral particles for high-throughput neutralization screening

  • Antibody Engineering Approaches:

    • Apply phage display with stringent selection conditions to identify rare neutralizing clones

    • Implement affinity maturation through targeted mutagenesis of selected antibodies

    • Create bispecific antibodies targeting multiple epitopes simultaneously

    • Develop camelid single-domain antibodies (VHH) for accessing restricted epitopes

These methodological solutions significantly improve the likelihood of generating functionally relevant neutralizing antibodies against FPV182, addressing the inherent challenges of this conserved but complex viral membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.