Recombinant Francisella philomiragia subsp. philomiragia Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant plsY is derived from Francisella philomiragia subsp. philomiragia (strain ATCC 25017) and produced in E. coli or mammalian cell systems . Key features include:

PropertyDetails
UniProt IDB0TYY2
Gene NameplsY (Fphi_1503)
Protein Length204 amino acids (full-length)
TagN-terminal His tag (for purification)
SequenceMNFLNFSMLVFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGNVPAIITLA FDILKGLVPVVLAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGVATLIGTLFGFSW ILGLIFVVTWLCVAVITRYSSLSALVATVIASFSVIFTSDLQVATPFLIIAIIILVKHKG NIQRLISGQESKIGDKAKAKNDSN
SynonymsGPAT, Lysophosphatidic acid synthase, Acyl-phosphate--glycerol-3-phosphate acyltransferase

Infectious Disease Studies

F. philomiragia is an opportunistic pathogen associated with near-drowning infections and granulomatous diseases . The plsY enzyme is implicated in bacterial membrane lipid synthesis, a potential therapeutic target. Studies show:

  • Macrophage Cytotoxicity: F. philomiragia exhibits strain-dependent cytotoxicity in murine and human macrophages .

  • Antimicrobial Resistance: Demonstrates increased resistance to human cathelicidin LL-37 compared to F. tularensis subsp. novicida, suggesting unique lipid membrane adaptations .

Comparative Analysis

PlsY homologs exist in other Francisella species, such as F. tularensis subsp. tularensis (UniProt Q14H98), but differ in sequence and functional domains . The F. philomiragia variant shares 72% sequence identity with F. tularensis plsY, highlighting evolutionary conservation in lipid metabolism .

Significance in Biomedical Research

Recombinant plsY enables:

  1. Enzyme Kinetics Studies: Investigating substrate specificity and inhibitor screening.

  2. Antibody Development: Used as an antigen for monoclonal antibody production against Francisella spp. .

  3. Pathogenicity Research: Clarifying lipid biosynthesis roles in bacterial survival and host immune evasion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Fphi_1503; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Francisella philomiragia subsp. philomiragia (strain ATCC 25017)
Target Names
plsY
Target Protein Sequence
MNFLNFSMLVFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGNVPAIITLA FDILKGLVPVVLAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGVATLIGTLFGFSW ILGLIFVVTWLCVAVITRYSSLSALVATVIASFSVIFTSDLQVATPFLIIAIIILVKHKG NIQRLISGQESKIGDKAKAKNDSN
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Francisella philomiragia?

Glycerol-3-phosphate acyltransferase (plsY) is an essential enzyme in the bacterial phospholipid biosynthesis pathway. In Francisella philomiragia, plsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, creating lysophosphatidic acid (LPA), a critical intermediate in membrane phospholipid synthesis. The enzyme is also known as Acyl-PO4 G3P acyltransferase, GPAT, or LPA synthase. This initial acylation reaction is the first committed step in bacterial phospholipid biosynthesis and is essential for membrane formation and integrity . The plsY gene is conserved across Francisella species, including F. philomiragia, F. tularensis, and F. novicida, though with some sequence variations that reflect their evolutionary relationships .

What expression systems are most effective for producing recombinant F. philomiragia plsY?

For effective heterologous expression of Francisella proteins, including F. philomiragia plsY, E. coli expression systems with specific modifications are typically used. Standard protocols include:

  • Codon optimization for E. coli expression

  • Use of Francisella-specific promoters

  • Addition of affinity tags (commonly His-tag) for purification

The search results indicate that for Francisella proteins, "specific codon optimization for high-level plasmid-mediated protein expression" is required . Unlike many bacterial proteins, Francisella cannot effectively express proteins from standard E. coli plasmids without these modifications, as "Francisella cannot express exogenous Escherichia coli plasmids" .

For purification, the His-tagged recombinant protein approach has been successfully applied to F. tularensis proteins and would be suitable for F. philomiragia plsY as well .

What are the biochemical differences between plsY from F. philomiragia and other pathogenic Francisella species that might impact virulence or drug targeting?

The biochemical properties of plsY across Francisella species likely reflect their differing pathogenicity profiles. F. philomiragia is less virulent than F. tularensis, which might be partially attributed to differences in membrane composition resulting from variations in plsY activity or regulation.

While the search results don't provide specific biochemical comparison data for plsY across species, they do indicate that Francisella species differ in their virulence factors and protein expression patterns. Comparative proteomics studies have shown that "virulence factors... can be regulated by genes not contained in the FPI itself" , suggesting that metabolic enzymes like plsY could be differentially regulated between species with varying pathogenicity.

F. philomiragia has been reported to have a chromosomally encoded Class A carbapenemase gene, FPH-1, which provides broad-spectrum antibiotic resistance . This suggests that the genomic context in which plsY exists differs between species, potentially affecting its expression and function.

How does the substrate specificity of F. philomiragia plsY impact membrane phospholipid composition and bacterial survival under different environmental conditions?

The substrate specificity of plsY determines which fatty acids are incorporated into bacterial membrane phospholipids, directly influencing membrane fluidity, permeability, and adaptation to environmental stresses. Although specific data on F. philomiragia plsY substrate preferences are not provided in the search results, research on other Francisella species offers valuable insights.

Francisella species can form biofilms, which "were shown to have increased AMR compared to planktonic cells" . The membrane composition, influenced by plsY activity, likely plays a role in biofilm formation and consequently impacts environmental persistence and antibiotic resistance. The membrane phospholipid composition may also affect the bacterium's ability to survive in diverse environments, from water sources to mammalian hosts.

An experimental approach to determine substrate specificity would involve:

  • Expression and purification of recombinant F. philomiragia plsY

  • In vitro enzymatic assays with various acyl-phosphate substrates

  • Analysis of reaction products by chromatography and mass spectrometry

  • Correlation of results with the natural phospholipid composition of F. philomiragia membranes

What role does plsY play in antibiotic resistance mechanisms in F. philomiragia compared to other Francisella species?

The role of plsY in antibiotic resistance mechanisms is complex and multifaceted. As a key enzyme in membrane biosynthesis, plsY activity directly influences membrane composition and potentially affects antibiotic penetration and efflux pump function.

Francisella species exhibit intrinsic resistance to many antibiotics "due to the nature of its LPS and the many enzymes it produces" . While plsY is not directly mentioned as an antibiotic resistance determinant in the search results, membrane-associated proteins and lipid metabolism have been implicated in antibiotic resistance in various bacteria.

F. philomiragia specifically "is reported to have a chromosomally encoded Class A carbapenemase gene, FPH-1" that "confers reduced susceptibility to imipenem" and provides "a broad spectrum of resistance, including expanded-spectrum cephalosporins, aztreonam, and carbapenems" . The interaction between this resistance mechanism and membrane lipid composition, which is influenced by plsY activity, represents an important area for investigation.

What are the optimal conditions for expression and purification of recombinant F. philomiragia plsY while maintaining enzymatic activity?

Based on the information for similar recombinant proteins from Francisella species, the following protocol would be recommended:

Expression System:

  • E. coli expression system with Francisella-specific promoters

  • N-terminal His-tag for purification

  • Expression at reduced temperatures (16-20°C) to enhance proper folding

Purification Protocol:

  • Cell lysis in Tris/PBS-based buffer, pH 8.0

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography to remove aggregates

  • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Recommendations:

  • Store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

  • Add glycerol (final concentration 5-50%) for long-term storage

Reconstitution:

  • Centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (recommended final concentration 50%) for aliquoting and long-term storage

What genetic transformation methods are most effective for introducing recombinant plsY constructs into Francisella species for functional studies?

Several transformation methods have been successfully used for introducing recombinant constructs into Francisella species, which could be adapted for plsY studies in F. philomiragia:

  • Electroporation: Successfully used for F. tularensis

  • Cryotransformation: Effective for F. tularensis

  • Chemical competence: The method of choice for F. novicida

  • Triparental conjugation: Used for F. tularensis holarctica LVS and F. novicida

For F. philomiragia specifically, chemical competence or electroporation would likely be most suitable based on its genetic similarity to F. novicida.

Important considerations for genetic transformation include:

  • Use of Francisella-specific plasmid backbones (typically engineered from pFNL10)

  • Incorporation of Francisella-specific promoters for efficient expression

  • Selection of appropriate antibiotic resistance markers (avoiding those clinically useful for tularemia treatment, such as kanamycin)

  • Optimization of transformation conditions specific to F. philomiragia

What assay systems can accurately measure plsY enzymatic activity in vitro and in vivo for F. philomiragia?

In Vitro Enzymatic Assays:

  • Radiometric Assay: Measuring the incorporation of radiolabeled acyl groups into lysophosphatidic acid

    • Substrate: [14C]- or [3H]-labeled acyl-CoA or acyl-phosphate

    • Detection: Thin-layer chromatography followed by autoradiography or scintillation counting

  • Colorimetric/Fluorometric Assays: Measuring the release of inorganic phosphate or coenzyme A

    • Coupled enzyme assays where product formation is linked to a color-producing reaction

    • Suitable for high-throughput screening of inhibitors

  • Mass Spectrometry-Based Assays: Direct detection of reaction products

    • LC-MS/MS analysis of lysophosphatidic acid formation

    • Can detect multiple lipid species simultaneously to assess substrate specificity

In Vivo Activity Assessment:

  • Genetic Complementation: Testing whether F. philomiragia plsY can rescue growth of plsY-deficient E. coli or other Francisella species

  • Membrane Composition Analysis: Comparing phospholipid profiles between wild-type and plsY-modified strains

  • Growth Rate Analysis: Measuring growth under various conditions to assess the impact of plsY modifications

How can inhibitors of F. philomiragia plsY be identified and developed as potential antimicrobial agents?

The essential role of plsY in bacterial membrane synthesis makes it an attractive target for antimicrobial development. A systematic approach to identify and develop inhibitors would include:

  • High-Throughput Screening (HTS):

    • Develop a miniaturized enzymatic assay suitable for screening compound libraries

    • Screen diverse chemical libraries, including natural product extracts

    • Identify hit compounds that inhibit plsY activity at low micromolar concentrations

  • Structure-Based Drug Design:

    • Determine the three-dimensional structure of F. philomiragia plsY through X-ray crystallography or cryo-EM

    • Use computational modeling to identify potential binding sites

    • Design compounds predicted to interact with catalytic or allosteric sites

  • Lead Optimization:

    • Establish structure-activity relationships through systematic modification of hit compounds

    • Improve potency, selectivity, and pharmacokinetic properties

    • Test optimized compounds against whole bacteria to confirm antimicrobial activity

  • Specificity Considerations:

    • Test activity against mammalian GPAT enzymes to ensure selectivity

    • Evaluate activity against diverse bacterial species to determine spectrum of activity

    • Assess potential for resistance development through long-term exposure studies

What is the potential of F. philomiragia plsY as a vaccine antigen or diagnostic marker?

The immunogenic potential of F. philomiragia proteins, including plsY, represents an important research direction. Based on immunoproteomics studies of Francisella species, several approaches could be considered:

  • Evaluation as Vaccine Antigen:

    • Screen for antibody responses to plsY in recovered patients or animal models

    • Assess conservation across Francisella species to determine cross-protection potential

    • Evaluate cellular immune responses to plsY epitopes

The search results indicate that researchers have been "studying the antibody response to vaccination or infection with Francisella for many years" using methods such as "agglutination, ELISA, and 1D-Western blotting" . Modern approaches include "2D-Western blotting combined with protein identification by mass spectrometry" and "proteome microarray technology" that "prints recombinant proteins on glass slides to allow high throughput screening of immune sera" .

  • Diagnostic Applications:

    • Develop ELISA or other immunoassays using recombinant plsY

    • Evaluate sensitivity and specificity for detecting F. philomiragia infections

    • Compare antibody responses to plsY across different Francisella species infections

Proteome microarray studies have identified immunodominant proteins in Francisella that react with sera from infected individuals . By including F. philomiragia plsY in such arrays, its potential as a diagnostic marker could be assessed.

How can functional genomics approaches be applied to understand the role of plsY in F. philomiragia pathogenesis and environmental persistence?

Functional genomics approaches offer powerful tools to investigate plsY's role in F. philomiragia biology:

  • Gene Knockout/Knockdown Studies:

    • Create conditional plsY mutants (as complete knockouts may be lethal)

    • Analyze phenotypic changes in growth, membrane composition, and stress responses

    • Assess impacts on biofilm formation and antibiotic susceptibility

  • Transcriptomic Analysis:

    • Compare gene expression profiles between wild-type and plsY-modified strains

    • Identify co-regulated genes that may function in related pathways

    • Analyze expression changes under different environmental conditions

  • Proteomic Approaches:

    • Comparative proteomics between F. philomiragia and other Francisella species

    • Identification of protein interaction partners using pull-down assays

    • Analysis of membrane proteome changes in plsY-modified strains

The search results mention a "comprehensive transposon-insertion library and a phenotype screen in F. novicida" that "confirmed the presence of intrinsic antibiotic resistance genes, and identified some genes that were not previously known to be involved in AMR" . Similar approaches could be applied to study plsY in F. philomiragia.

What are the key knowledge gaps in our understanding of F. philomiragia plsY that should be addressed in future research?

Despite the importance of plsY in bacterial phospholipid biosynthesis, several knowledge gaps remain:

  • Structural Characterization: The three-dimensional structure of F. philomiragia plsY has not been determined, limiting structure-based drug design efforts.

  • Regulation Mechanisms: How plsY expression and activity are regulated in response to environmental conditions remains poorly understood.

  • Host-Pathogen Interactions: Whether host immune responses specifically target plsY or its products during infection is unknown.

  • Environmental Adaptation: The role of plsY in adapting membrane composition to different environmental niches that F. philomiragia inhabits needs investigation.

  • Comparative Biology: Detailed biochemical comparisons between plsY from F. philomiragia and other Francisella species would enhance our understanding of species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.