Recombinant Francisella philomiragia subsp. philomiragia Membrane Protein Insertase YidC (UniProt ID: B0TW73) is a full-length, His-tagged protein expressed in E. coli. It belongs to the YidC/Oxa1/Alb3 family of membrane insertases, which facilitate the integration and folding of transmembrane proteins into lipid bilayers . This recombinant protein is engineered for structural and functional studies of bacterial membrane protein biogenesis, particularly in Francisella species .
Amino Acid Sequence: Comprises 551 residues (MKANHIRILLLVTIAIMLISLMGRWEQTFPSNSSQSQTTQTQQDNSHYNSDTPATTNVSTSDAKASLTKTTSFSKYDDAKSVTINTDVFKNLKISLLDGAIISASLEDYSVSLDDKTPMALLTDEQGSEYIAKSTIVINKKPVDVNFESQGIKKENGKQVLTLTGSVDGLEITRTYTFDDKYNISVSQNIKNTTSEPVSVIIDDSLARDFNPAGDSFSLLNAHSYTFTGVAYSTANDSFRKESFKDISKTNGQPTVINSQGLGWVAFIQHYFVSAWIPQSNDSKIYYKNLNNDVFEAGAYTGISIAPNQSESIDSVLYSGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNQIHSSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRVKRLQETYKDDRQVLGKKMMEMYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPI LMGISMFLQQKLSPAPADPMQAKIMMFLPVIFTFLFASFPSGLVLYWLTNNVISILQQWIITRHYQATHKK) .
Key Domains:
| Parameter | Specification |
|---|---|
| Expression Host | Escherichia coli |
| Purity | >90% (SDS-PAGE) |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer, 6% trehalose, pH 8.0 |
| Reconstitution | 0.1–1.0 mg/mL in sterile water; 5–50% glycerol |
| Tag | N-terminal His tag |
YidC functions as a chaperone and insertase for polytopic membrane proteins:
Accelerates insertion kinetics by stabilizing folding intermediates .
Binds hydrophobic regions of substrates (e.g., Pf3 coat protein) via its α-helical hairpin domain within 2 ms, followed by insertion into the membrane within 52 ms .
Critical for Sec-independent pathways but also collaborates with SecYEG for complex substrates .
Francisella philomiragia YidC shares 97% sequence identity with F. tularensis YidC (UniProt ID: A4J015), differing in 16 residues within the C-terminal domain .
Unlike E. coli YidC, Francisella YidC lacks a conserved Arg-rich motif in the hydrophilic groove, potentially altering substrate specificity .
Mechanistic Studies: Used in single-molecule force spectroscopy (SMFS) to analyze substrate binding and insertion dynamics .
Drug Discovery: Target for antimicrobials due to its essential role in bacterial membrane biogenesis .
Structural Biology: Crystallization trials for resolving full-length YidC architecture .
KEGG: fph:Fphi_0760
STRING: 484022.Fphi_0760
Membrane Protein Insertase YidC in Francisella philomiragia functions primarily as a critical component in membrane protein biogenesis. YidC assists in the insertion, folding, and assembly of proteins into the cytoplasmic membrane. It operates through two distinct pathways:
Sec-dependent pathway: YidC works in conjunction with the Sec translocon to facilitate proper insertion and folding of membrane proteins.
Sec-independent pathway: YidC functions autonomously to insert specific substrate proteins directly into the lipid bilayer .
This dual functionality makes YidC essential for maintaining membrane integrity and proper cellular function in F. philomiragia. Research has demonstrated that YidC can independently integrate proteins like the Pf3 coat protein into proteoliposomes, confirming its sufficiency for membrane integration of Sec-independent proteins .
For optimal expression of recombinant F. philomiragia YidC in E. coli systems, researchers should consider the following methodological approach:
Expression System Setup:
Vector Selection: Use vectors with strong inducible promoters (T7 or tac) that allow tight regulation of expression.
Host Strain: E. coli strains specifically designed for membrane protein expression such as C41(DE3) or C43(DE3) yield better results than standard BL21(DE3).
Temperature Management: Lower induction temperatures (16-18°C) significantly improve proper folding and reduce inclusion body formation.
Induction Protocol:
Grow cultures to mid-log phase (OD600 of 0.6-0.8)
Induce with low concentrations of IPTG (0.1-0.2 mM)
Continue expression for 16-20 hours at 18°C
According to production data from recombinant F. philomiragia YidC preparations, the protein is typically purified with an N-terminal His-tag to facilitate purification, and stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .
For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant for long-term storage at -20°C/-80°C .
Effective reconstitution of YidC into proteoliposomes requires careful attention to lipid composition, protein-to-lipid ratios, and buffer conditions. The following protocol has been validated for functional studies:
Materials Required:
Purified recombinant YidC protein
E. coli polar lipid extract or synthetic lipid mixtures (POPE:POPG at 3:1 ratio)
Detergent (n-dodecyl-β-D-maltoside or Triton X-100)
Bio-Beads SM-2 or Detergent Removal Resin
Protocol:
Liposome Preparation:
Dissolve lipids in chloroform, dry under nitrogen, and resuspend in buffer
Subject to freeze-thaw cycles (5-10 times) and extrude through 400 nm filters
Protein Incorporation:
Solubilize preformed liposomes with detergent
Add purified YidC at protein-to-lipid ratios of 1:100 to 1:200 (w/w)
Incubate at room temperature for 30 minutes with gentle mixing
Detergent Removal:
Add Bio-Beads SM-2 in sequential steps:
1st addition: 30 mg/ml, incubate 2h at room temperature
2nd addition: 60 mg/ml, incubate 2h at room temperature
3rd addition: 60 mg/ml, incubate overnight at 4°C
Remove Bio-Beads and collect proteoliposomes by ultracentrifugation
Resuspend in buffer for functional assays
This methodology has been successfully used to demonstrate that YidC can function independently of the Sec translocase to integrate membrane proteins into the lipid bilayer . Specifically, YidC proteoliposomes (approximately 50 YidC molecules per liposome) showed efficient insertion of the Pf3 coat protein within 30 minutes when energized with a membrane potential .
To verify the insertase activity of recombinant F. philomiragia YidC, researchers can employ several complementary experimental approaches:
In Vitro Assays:
Proteoliposome Insertion Assays:
Reconstitute purified YidC into proteoliposomes
Add radiolabeled or fluorescently tagged substrate proteins (e.g., Pf3 coat protein)
Monitor insertion via protease protection assays
Quantify insertion efficiency using SDS-PAGE and phosphorimaging
Real-time Kinetic Measurements:
Utilize stopped-flow fluorescence spectroscopy with fluorescently labeled substrates
Monitor changes in fluorescence upon insertion into membranes
Calculate insertion rates under varying conditions
In Vivo Approaches:
Complementation Studies:
Use YidC-depleted E. coli strains
Express F. philomiragia YidC and measure restoration of growth
Assess membrane protein levels of known YidC-dependent substrates
Reporter Fusion Assays:
Create fusion constructs of YidC substrates with reporter proteins (e.g., alkaline phosphatase)
Measure activity of the reporter to assess proper membrane insertion
Research has shown that when YidC proteoliposomes were energized with a membrane potential, the purified Pf3 coat protein was efficiently inserted within 30 minutes, with significantly higher insertion rates compared to control liposomes without YidC . The insertion kinetics followed a time-dependent curve, reaching maximum insertion after approximately 30 minutes of incubation with YidC-containing proteoliposomes .
Functional differences between F. philomiragia YidC and its homologs in other Francisella species, particularly F. tularensis, reflect their distinct ecological niches and pathogenic potentials:
Comparative Functional Analysis:
| Feature | F. philomiragia YidC | F. tularensis YidC |
|---|---|---|
| Sequence homology | Reference | 85-90% identity |
| Substrate specificity | Broader range of hydrophobic substrates | May have evolved specificity for virulence factors |
| Expression pattern | Constitutive expression | Potentially regulated during infection |
| Antimicrobial peptide resistance | Associated with higher resistance to LL-37 and mCRAMP | Less resistance to antimicrobial peptides |
F. philomiragia shows significantly higher resistance to human cathelicidin LL-37 (EC50 = 3.61 μg/mL) compared to F. tularensis subsp. LVS (EC50 = 1.15 μg/mL) and F. tularensis subsp. novicida (EC50 = 0.0724 μg/mL) . This increased resistance may be related to differences in membrane protein composition and folding, potentially influenced by YidC function.
F. philomiragia YidC's role in proper membrane protein insertion might contribute to the bacterium's adaptability to brackish environments, whereas F. tularensis YidC may have evolved to function optimally within host cells, potentially contributing to its higher virulence through specialized membrane protein insertion requirements for intracellular survival and immune evasion.
Molecular dynamics (MD) simulations offer powerful insights into the atomic-level mechanisms of YidC-mediated membrane insertion that are difficult to observe experimentally:
Simulation Approaches and Their Applications:
Equilibrium MD Simulations:
Reveal stable conformational states of YidC within the lipid bilayer
Identify key water molecules and lipid interactions in the hydrophilic groove
Map electrostatic potential surfaces that guide substrate proteins
Non-Equilibrium MD (NEMD) Simulations:
Model the dynamic process of substrate insertion
Calculate energy barriers during various insertion stages
Identify rate-limiting steps in the insertion process
Key Findings from MD Studies:
Recent MD simulations of YidC-mediated insertion of the Pf3 coat protein revealed critical mechanistic details :
The transmembrane helices (TM1a, TM2, TM3, TM4, and TM5) of YidC become more slanted during Pf3 coat protein insertion, with angle differences exceeding 10 degrees compared to the resting state
The central TM groove of YidC significantly enlarges to accommodate the inserting protein
Critical helices TM1a and TM2 undergo substantial conformational changes, stretching toward the cytoplasmic side to create an entrance point for the substrate protein
The insertion process involves a gradual conformational shift in YidC that progressively expands the transmembrane groove to accommodate the incoming peptide
The proposed mechanism based on these simulations suggests that:
The incoming substrate first interacts with cytoplasmic loops of YidC
It gradually moves into the hydrophilic groove in the transmembrane region
Specific salt bridge interactions (e.g., between D7 of Pf3 and R72 of YidC) are critical for insertion
Dehydration of the groove occurs as the substrate moves deeper
The N-terminal portion migrates toward the periplasmic side, assisted by hydrophobic interactions with lipid tails
These computational insights provide testable hypotheses for experimental validation and rational design of insertion assays.
YidC's potential contribution to antimicrobial resistance in F. philomiragia represents an emerging area of research with significant implications:
Mechanisms of YidC-Related Antimicrobial Resistance:
Antimicrobial Peptide Resistance:
F. philomiragia demonstrates significantly higher resistance to antimicrobial peptides compared to related Francisella species. Specifically:
LL-37 (human cathelicidin): F. philomiragia EC50 = 3.61 μg/mL, 3-fold more resistant than F. tularensis subsp. LVS (EC50 = 1.15 μg/mL) and 50-fold more resistant than F. tularensis subsp. novicida (EC50 = 0.0724 μg/mL)
mCRAMP (murine cathelicidin): F. philomiragia EC50 = 5.27 μg/mL, 14-fold more resistant than F. tularensis subsp. LVS (EC50 = 0.381 μg/mL) and 116-fold more resistant than F. tularensis subsp. novicida (EC50 = 0.0453 μg/mL)
YidC likely contributes to this resistance by ensuring proper insertion and folding of membrane proteins that modify surface properties, potentially including:
LPS modification enzymes
Efflux pump components
Membrane-associated proteases that degrade antimicrobial peptides
β-lactam Resistance:
F. philomiragia has demonstrated resistance to certain β-lactam antibiotics, potentially through YidC-mediated insertion of:
β-lactamase enzymes
Penicillin-binding proteins (PBPs) with reduced affinity for β-lactams
Membrane proteins that decrease membrane permeability
Research has shown that YidC assists in the biogenesis of penicillin binding proteins (PBPs), which are critical for peptidoglycan synthesis and are targets for β-lactam antibiotics . In the absence of YidC, certain critical PBPs are not correctly folded even when the total protein amount in the membrane remains unchanged , suggesting a quality control role for YidC in maintaining functional PBPs that could affect antibiotic resistance.
Maintaining stability of purified recombinant F. philomiragia YidC presents several challenges due to its hydrophobic nature and complex membrane topology. Here are evidence-based strategies to overcome these issues:
Storage and Handling Recommendations:
Buffer Optimization:
Temperature Management:
Concentration Effects:
Keep protein concentrations between 0.1-1.0 mg/mL to prevent aggregation
For higher concentration needs, add stabilizing agents like glycerol or specific lipids
Consider reconstituting into nanodiscs for improved stability at higher concentrations
Experimental Validation:
When implementing these strategies, researchers should verify protein stability and functionality through:
Circular dichroism to confirm secondary structure maintenance
Size-exclusion chromatography to monitor aggregation state
Functional assays using model substrates like Pf3 coat protein to confirm insertase activity
Differentiating between direct and indirect effects in YidC knockout studies requires a systematic approach using complementary strategies:
Experimental Design Framework:
Conditional Depletion Systems:
Use inducible promoters (e.g., arabinose-inducible) to create YidC depletion strains rather than complete knockouts
Monitor phenotypic changes at different depletion timepoints to distinguish immediate (likely direct) from delayed (potentially indirect) effects
Create calibration curves correlating YidC levels with phenotypic severity
Substrate-Specific Assays:
Identify known YidC substrates in F. philomiragia through homology to E. coli substrates
Develop targeted assays for individual substrate proteins
Use pulse-chase experiments to monitor kinetics of substrate insertion before secondary effects occur
Complementation Analysis:
Create point mutations in functional domains of YidC
Perform domain swapping between F. philomiragia YidC and homologs
Use these variants in complementation assays to identify specific functions
Multi-omics Integration:
Combine transcriptomics, proteomics, and metabolomics data
Use temporal sampling to distinguish primary from secondary responses
Apply network analysis to identify direct connections to YidC function
Case Study Example:
Research on YidC's role in PBP biogenesis demonstrates the challenge of differentiating direct and indirect effects. In the absence of YidC, critical penicillin binding proteins show incorrect folding even though their total membrane abundance remains unchanged . This suggests YidC acts directly as a foldase for periplasmic domains rather than as an insertase in this context, highlighting the need for assays that specifically distinguish between insertion and folding functions.
Systematic characterization of YidC substrate specificity in F. philomiragia has significant potential to inform vaccine development against pathogenic Francisella species, particularly F. tularensis:
Research Approach:
Comparative Substrate Profiling:
Identify the complete repertoire of YidC-dependent membrane proteins in F. philomiragia using proteomics approaches
Compare with homologous proteins in F. tularensis to identify conserved YidC substrates
Focus on substrates present in both species that may be essential for survival
Virulence Factor Analysis:
Vaccination Strategy Implications:
Proteins dependent on YidC for proper folding, especially those that are surface-exposed, represent promising vaccine candidates because:
They are often essential proteins with conserved epitopes
Antibodies targeting misfolded versions may not be protective
YidC-dependent proteins can be co-purified for multivalent vaccine formulations
Preliminary studies have shown that certain anti-Francisella hybridoma antibodies recognize YidC-dependent membrane proteins and confer protection in mouse models . For example, antibody 17 was found to recognize FTT0233c, an inner membrane protein homologous to YidC , suggesting YidC-associated proteins can be immunogenic and protective.
Understanding F. philomiragia YidC function has important implications for clinical infections, particularly in immunocompromised patients and near-drowning victims:
Clinical Relevance and Research Opportunities:
Infection Mechanism Insights:
F. philomiragia causes pneumonia and systemic infections in immunocompromised individuals . YidC's role in membrane protein biogenesis likely contributes to:
Adaptation to the host environment during infection
Assembly of secretion systems needed for virulence
Proper folding of adhesins and invasins involved in host cell entry
Diagnostics Development:
YidC-dependent proteins may serve as biomarkers for improved diagnostics, addressing the current challenge that F. philomiragia "is difficult to identify through conventional Gram-staining and biochemical methods due to an amorphous Gram stain appearance after 24h culture and its relatively fastidious and slow growth" .
Therapeutic Target Assessment:
Comparative studies between F. philomiragia and F. tularensis YidC could reveal:
Conserved structural features that could be targeted by novel antibiotics
Differences in substrate specificity that explain virulence variations
Potential for YidC inhibitors as broad-spectrum Francisella treatments
Recent case reports highlight that F. philomiragia infections present clinical challenges. In one case, a 34-year-old man with acute lymphoblastic leukemia developed F. philomiragia bacteremia after chemotherapy . Another case involved an immunocompromised patient who developed pneumonia with pulmonary nodules, which are described as "the most common manifestations of F. philomiragia infection" .