Recombinant Francisella philomiragia subsp. philomiragia Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role of Lgt in Bacterial Physiology

Lgt catalyzes the first step in lipoprotein maturation, enabling the formation of diacylated lipoproteins. These lipoproteins are essential for bacterial membrane integrity, nutrient uptake, and pathogenesis. Key steps in lipoprotein biosynthesis include:

  1. Signal Peptide Cleavage: Lipoproteins are secreted via the Sec or Tat pathways.

  2. Lgt-Mediated Diacylation: Lgt transfers a diacylglyceryl group to cysteine +1, creating a thioether-linked anchor.

  3. Signal Peptidase II (Lsp) Processing: Cleaves the signal peptide, releasing mature lipoproteins.

  4. Apolipoprotein N-acyltransferase (Lnt) Activity: Adds a third acyl group in some species (e.g., Proteobacteria).

Potential Research Directions:

  • Enzyme Specificity: Determine substrate preferences (e.g., phosphatidylglycerol vs. other phospholipids).

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve F. philomiragia Lgt’s active site.

  • Antibacterial Targets: Explore Lgt inhibition as a therapeutic strategy, leveraging conserved residues (Y26, N146).

Research Gaps and Challenges

Despite its importance, F. philomiragia Lgt remains uncharacterized due to:

  1. Limited Genomic Data: The lgt gene is annotated but not experimentally validated.

  2. Functional Redundancy: Overlapping roles with other lipid-modifying enzymes (e.g., Lsp, Lnt).

  3. Biohazard Restrictions: F. philomiragia is a Biosafety Level 2 organism, complicating large-scale studies.

Comparative Insights from Other Bacteria

While F. philomiragia Lgt is understudied, insights from E. coli and Thermus thermophilus highlight its potential:

OrganismKey FindingsRelevance to F. philomiragia
E. coliLgt depletion is lethal; essential residues include Y26, N146, G154 .Conserved motifs likely critical in F. philomiragia.
T. thermophilusRecombinant Lgt (His-tagged) available for structural/functional studies .Template for F. philomiragia Lgt production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery information, please contact your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lgt; Fphi_1433; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Francisella philomiragia subsp. philomiragia (strain ATCC 25017)
Target Names
lgt
Target Protein Sequence
MLHYPQIDPVALHLGPIKVHWYGLMYLFGIFAGWYLLRYRAKVKSWAPIKPEQAGDLTFY IALGVILGGRIGYIIFYNLPYYFHNPLQMFFLWDGGMSFHGGFIGVLIAFALYARKLGVN FFDLGEFVAPVVPIGLGAGRIGNFINGELWGKVTDSPIGMIFPTGGPLPRYPSQLFEFFL EGVVLFTVLWLVSIKKRPRYLILGLFMFLYGSARFICEFFRQPDPQYGYIFFNWMTMGQI LSIPMIVLGAIILIIVFIRTRKNKCENI
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (lgt) in F. philomiragia?

Prolipoprotein diacylglyceryl transferase (lgt) in Francisella philomiragia is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. The enzyme transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine in prolipoproteins, forming a thioether linkage. This reaction results in the formation of a diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . The lgt gene in F. philomiragia encodes this essential enzyme, which plays a critical role in membrane integrity and bacterial survival.

How does F. philomiragia lgt compare to lgt in other bacterial species?

F. philomiragia lgt functions similarly to lgt in other bacterial species, particularly the well-studied Escherichia coli lgt. Both enzymes catalyze the transfer of diacylglyceryl groups to prolipoproteins, and both are inner membrane proteins essential for bacterial growth . While the core catalytic function is conserved, there may be structural differences that reflect the distinct membrane compositions and environmental adaptations of these bacteria. F. philomiragia, as a saprophytic gammaproteobacterium that occasionally infects immunocompromised individuals, may have evolved specific adaptations in its lgt protein to function optimally in diverse environments .

What is the genomic context of lgt in F. philomiragia?

The lgt gene in F. philomiragia is part of the complete genome that was sequenced and deposited in GenBank under accession number NC_010336.1 . Unlike some virulence-associated genes in F. tularensis that appear in duplicated pathogenicity islands, the lgt gene in F. philomiragia is present as a single copy. This genomic organization reflects the different evolutionary paths taken by F. philomiragia and its more pathogenic relative, F. tularensis. The genome of F. philomiragia shows substantial differences with respect to putative virulence factors described in F. tularensis Schu S4, which may contribute to its lower pathogenicity in immunocompetent hosts .

What are the optimal conditions for expressing recombinant F. philomiragia lgt?

For optimal expression of recombinant F. philomiragia lgt, researchers should consider the following approach based on successful protocols for related bacterial membrane proteins:

  • Expression System: E. coli BL21(DE3) or similar strains are recommended for expression of recombinant membrane proteins.

  • Vector Selection: Vectors containing T7 promoters with His-tag or other affinity tags facilitate purification. Consider using vectors that allow for tight regulation of expression, as membrane proteins can be toxic when overexpressed.

  • Growth Conditions: Culturing at lower temperatures (16-25°C) after induction can improve the yield of properly folded membrane proteins. Host-adapted conditions (such as BHI medium at pH 6.8) can be used to mimic the physiological environment of F. philomiragia .

  • Induction Parameters: Lower concentrations of IPTG (0.1-0.5 mM) and longer induction times may improve expression of functional protein.

  • Membrane Fraction Isolation: Careful isolation of membrane fractions through differential centrifugation is crucial for recovering the membrane-bound lgt protein.

What purification strategies are most effective for F. philomiragia lgt?

Effective purification of recombinant F. philomiragia lgt requires specialized approaches for membrane proteins:

  • Solubilization: Detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin are commonly used to solubilize membrane proteins. The optimal detergent should be determined empirically.

  • Affinity Chromatography: If the recombinant lgt contains an affinity tag (His, GST, etc.), the corresponding affinity chromatography can be used as the first purification step.

  • Size Exclusion Chromatography: This technique separates proteins based on size and can be used to remove aggregates and further purify the lgt protein in its native oligomeric state.

  • Ion Exchange Chromatography: Depending on the theoretical isoelectric point of F. philomiragia lgt, either cation or anion exchange chromatography can provide additional purification.

  • Protein Stability: Throughout purification, it's essential to maintain the protein in a stabilizing buffer containing appropriate detergent concentrations and potentially phospholipids to mimic the native membrane environment.

How can the activity of purified recombinant F. philomiragia lgt be verified?

The activity of purified recombinant F. philomiragia lgt can be verified through several approaches:

  • Enzymatic Activity Assay: Measure the transfer of diacylglyceryl groups from phosphatidylglycerol to a peptide substrate by quantifying the release of glycerol phosphate, which is a by-product of the reaction . The peptide substrate can be derived from known lipoproteins, such as the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine that is modified by Lgt) .

  • Complementation Assay: Test the ability of the recombinant F. philomiragia lgt to complement an E. coli lgt depletion strain. Since lgt is essential for bacterial growth, restoration of growth in the depletion strain would confirm the functionality of the recombinant protein .

  • Mass Spectrometry: Analyze the modification of substrate peptides using mass spectrometry to directly observe the addition of diacylglyceryl groups.

  • Western Blotting: Use antibodies against known lipoproteins to detect proper modification in a system where endogenous lgt has been depleted and replaced with the recombinant F. philomiragia lgt.

What enzymatic assays can be used to measure F. philomiragia lgt activity?

Several enzymatic assays can be employed to measure F. philomiragia lgt activity:

  • Glycerol Phosphate Release Assay: This assay measures the release of glycerol-1-phosphate (G1P), which is the expected by-product of the Lgt enzymatic activity . The assay can be coupled with enzymes that convert G1P to a product that generates a colorimetric or fluorescent signal.

  • Radiolabeled Substrate Assay: Using radiolabeled phosphatidylglycerol as a substrate allows for the detection of the transfer of labeled diacylglyceryl groups to peptide substrates.

  • HPLC or TLC-Based Assays: High-performance liquid chromatography (HPLC) or thin-layer chromatography (TLC) can be used to separate and quantify the products of the lgt reaction.

  • Fluorescence Resonance Energy Transfer (FRET): FRET-based assays can be developed using labeled substrates to monitor the lgt-catalyzed reaction in real-time.

What are suitable peptide substrates for F. philomiragia lgt assays?

The ideal peptide substrates for F. philomiragia lgt assays should contain the lipobox motif, which is the recognition sequence for lipoprotein processing:

  • Consensus Sequence: The lipobox motif [L−4-A(S)−3-G(A)−2-C+1] is critical, where the invariant cysteine +1 becomes the first amino acid of the mature protein after modification .

  • Specific Examples: The Pal-IAAC peptide, derived from the Pal lipoprotein, has been successfully used as a substrate for lgt activity assays . Other peptides containing the consensus lipobox sequence from known F. philomiragia lipoproteins could also be designed.

  • Substrate Optimization: Variations in the amino acid sequence flanking the lipobox can affect substrate recognition and efficiency. Researchers may need to test multiple peptide substrates to identify the optimal sequence for F. philomiragia lgt.

  • Synthetic Considerations: Peptide substrates should be of sufficient length to ensure proper recognition and binding by lgt, typically including the signal peptide and several residues of the mature protein.

How can inhibition of F. philomiragia lgt be measured?

Inhibition of F. philomiragia lgt can be measured using several approaches:

  • IC50 Determination: Using the glycerol phosphate release assay, researchers can determine the concentration of inhibitor required to reduce enzyme activity by 50% (IC50).

  • Kinetic Analysis: By varying substrate concentrations in the presence of different inhibitor concentrations, researchers can determine the mechanism of inhibition (competitive, non-competitive, or uncompetitive) and derive inhibition constants (Ki).

  • Thermal Shift Assays: These assays measure the change in protein thermal stability upon inhibitor binding, providing insights into binding affinity.

  • Cellular Assays: The effect of potential inhibitors on F. philomiragia growth or survival can be assessed in bacterial cultures, macrophages, or other relevant cell types .

What structural features are important for F. philomiragia lgt function?

While specific structural information about F. philomiragia lgt is limited, insights can be drawn from studies of related bacterial lgt proteins:

  • Membrane Topology: As an inner membrane protein, F. philomiragia lgt likely has multiple transmembrane domains that anchor it in the membrane and position the active site to access both the phosphatidylglycerol substrate in the membrane and the prolipoprotein substrate .

  • Active Site Residues: The active site of lgt typically contains conserved residues that coordinate the catalytic transfer of the diacylglyceryl group. These may include cysteine residues that are critical for function.

  • Substrate Binding Pockets: Distinct binding regions for the phosphatidylglycerol and prolipoprotein substrates are expected, with specific interactions that ensure proper orientation for the transfer reaction.

  • Conserved Motifs: Comparison with other bacterial lgt proteins may reveal conserved motifs that are essential for function, providing targets for site-directed mutagenesis studies.

How can site-directed mutagenesis be used to study F. philomiragia lgt?

Site-directed mutagenesis is a powerful approach to investigate the structure-function relationships of F. philomiragia lgt:

  • Identification of Key Residues: Based on sequence alignment with well-studied lgt proteins, researchers can identify putative catalytic or substrate-binding residues.

  • Mutagenesis Strategy: Alanine scanning mutagenesis, where individual residues are systematically replaced with alanine, can help identify amino acids critical for enzyme function.

  • Functional Analysis: Complementation assays in lgt depletion strains can determine if mutated versions of F. philomiragia lgt retain the ability to support bacterial growth .

  • Biochemical Characterization: In vitro activity assays with purified mutant enzymes can quantify the effect of specific mutations on catalytic efficiency, substrate binding, and other kinetic parameters.

  • Correlation with Structure: If structural data becomes available, mutagenesis results can be interpreted in the context of the three-dimensional structure to develop a more comprehensive understanding of the enzyme mechanism.

What computational approaches can predict F. philomiragia lgt inhibitors?

Several computational approaches can be employed to predict potential inhibitors of F. philomiragia lgt:

  • Homology Modeling: If the structure of F. philomiragia lgt is not experimentally determined, homology models can be built based on related bacterial lgt structures to serve as templates for virtual screening.

  • Molecular Docking: Computational docking of virtual compound libraries to the predicted active site of F. philomiragia lgt can identify molecules with favorable binding energies.

  • Pharmacophore Modeling: Based on known inhibitors of related bacterial lgt enzymes, pharmacophore models can be developed to search for compounds with similar chemical features.

  • Molecular Dynamics Simulations: These simulations can provide insights into the dynamic behavior of F. philomiragia lgt and its interactions with potential inhibitors, helping to refine inhibitor design.

  • Machine Learning Approaches: Machine learning algorithms trained on datasets of known enzyme inhibitors can be used to predict compounds likely to inhibit F. philomiragia lgt.

How can F. philomiragia lgt be studied in cellular infection models?

F. philomiragia lgt can be studied in various cellular infection models to understand its role in pathogenesis:

  • Macrophage Infection: F. philomiragia has been shown to infect and proliferate in murine macrophages (J774A.1 cells) to higher levels than F. tularensis subspecies novicida and LVS . This model can be used to study the role of lgt in intracellular survival and replication.

  • Human Lung Epithelial Cells: A549 cells have been used to study F. philomiragia infection . This model is particularly relevant considering that F. philomiragia infections in humans often occur following near-drowning incidents, suggesting direct lung inoculation.

  • Hepatocytes: F. philomiragia can infect human hepatocyte-like cells (HepG2), making this a useful model to study liver infection dynamics .

  • Gene Knockdown/Knockout: RNA interference or CRISPR-Cas9 approaches in F. philomiragia can be used to reduce or eliminate lgt expression, allowing researchers to study the consequences of lgt deficiency on bacterial survival and virulence.

  • Complementation Studies: Introduction of wild-type or mutant lgt genes into lgt-deficient F. philomiragia can help elucidate the importance of specific residues or domains for function in cellular contexts.

What animal models are appropriate for studying F. philomiragia lgt function?

Several animal models have been established for studying F. philomiragia infections and can be adapted to investigate lgt function:

  • Galleria mellonella (Wax Moth Larvae): This invertebrate model has been demonstrated to be useful for F. philomiragia infection studies, with an established LD50 of approximately 1.8 × 10^3 CFU/mL (or ~18 CFU with a 10 μL inoculation volume) . This model offers a ethical and cost-effective approach for initial in vivo studies.

  • BALB/c Mice: Intranasal infection of BALB/c mice has been established as a model for F. philomiragia infection . This mammalian model more closely resembles human infections and can provide insights into the role of lgt in pulmonary infection.

  • Conditional Knockout Approaches: Given that lgt is likely essential for F. philomiragia survival, conditional gene expression systems could be developed to study the effects of lgt depletion during different stages of infection.

  • Competitive Index Assays: Co-infection with wild-type and lgt-modified F. philomiragia strains can help quantify the relative fitness of different strains in vivo.

How does F. philomiragia lgt contribute to antimicrobial peptide resistance?

F. philomiragia shows increased resistance to antimicrobial peptides, which may be related to lgt function:

  • Cathelicidin Resistance: F. philomiragia grown in host-adapted conditions (BHI, pH 6.8) shows increased resistance to the human cathelicidin LL-37 and murine cathelicidin mCRAMP compared to related Francisella species . The EC50 of LL-37 against F. philomiragia is 3.61 μg/mL, which is 3-fold higher than for F. tularensis subsp. LVS (EC50 = 1.15 μg/mL) and 50-fold higher than for F. tularensis subsp. novicida (EC50 = 0.0724 μg/mL) .

  • Membrane Modifications: The increased resistance of F. philomiragia to cationic antimicrobial peptides could be due to differences in the lipopolysaccharide (LPS) or other surface properties influenced by proper lipoprotein processing, which depends on lgt function .

  • Host-Adapted Phenotype: Growth in BHI (pH 6.8) alters the surface carbohydrate and gene expression in F. philomiragia in a way that mimics the "host-adapted" phenotype, potentially affecting lgt activity and subsequent membrane properties .

  • Experimental Approaches: Researchers can investigate the role of lgt in antimicrobial peptide resistance by comparing the susceptibility of wild-type F. philomiragia to strains with modified lgt expression or activity.

What are the characteristics of effective F. philomiragia lgt inhibitors?

While specific inhibitors of F. philomiragia lgt have not been extensively studied, insights can be drawn from research on other bacterial lgt enzymes:

  • Target Specificity: Effective inhibitors should specifically target bacterial lgt without affecting host enzymes, reducing the risk of toxicity.

  • Mechanism of Action: Inhibitors may act by competing with natural substrates (phosphatidylglycerol or prolipoprotein), binding to the active site, or inducing conformational changes that prevent catalysis.

  • Chemical Properties: Given that lgt is a membrane protein, inhibitors likely need to possess properties that allow them to access the enzyme within the bacterial membrane environment.

  • Structure-Activity Relationships: By studying the relationship between inhibitor structure and activity, researchers can identify key chemical features necessary for potent inhibition.

  • Synergistic Effects: Combinations of lgt inhibitors with other antimicrobials might enhance efficacy, particularly against resistant strains.

How can high-throughput screening be optimized for F. philomiragia lgt inhibitors?

Optimizing high-throughput screening for F. philomiragia lgt inhibitors involves several considerations:

  • Assay Development: Adaptation of the glycerol phosphate release assay to a microplate format can enable rapid screening of compound libraries . The assay should be robust, reproducible, and amenable to automation.

  • Substrate Selection: Using optimized peptide substrates derived from F. philomiragia lipoproteins can improve the relevance of screening results.

  • Confirmation Strategies: Hit compounds from primary screens should be confirmed through secondary assays, including direct binding assays and bacterial growth inhibition tests.

  • Counter-Screening: Testing hit compounds against human enzymes can identify potential off-target effects and help prioritize compounds with favorable selectivity profiles.

  • Medicinal Chemistry Follow-up: Promising inhibitor scaffolds can be further optimized through medicinal chemistry approaches to improve potency, selectivity, and physicochemical properties.

What is the potential of F. philomiragia lgt as an antimicrobial target?

F. philomiragia lgt represents a potential antimicrobial target for several reasons:

  • Essential Function: Lgt is essential for bacterial growth, as demonstrated in E. coli through the analysis of an lgt depletion strain . Inhibiting this enzyme would likely be bactericidal.

  • Conserved Across Bacteria: The lgt enzyme is highly conserved across bacterial species, suggesting that inhibitors developed against F. philomiragia lgt might have broad-spectrum activity.

  • Absent in Humans: Humans do not possess homologs of bacterial lgt, reducing the risk of on-target toxicity.

  • Relevance to Opportunistic Infections: Although F. philomiragia primarily affects immunocompromised individuals, the development of lgt inhibitors could provide treatment options for these vulnerable populations.

  • Model System Advantages: The Biosafety Level 2 status of F. philomiragia makes it an attractive model for studying lgt inhibition before testing against more pathogenic species like F. tularensis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.