Recombinant Francisella tularensis subsp. holarctica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role

Glycerol-3-phosphate acyltransferases (GPATs) initiate lipid biosynthesis by acylating glycerol-3-phosphate, forming lysophosphatidic acid (LPA). In F. tularensis, plsY may:

  • Synthesize membrane lipids: Contributing to outer membrane integrity and virulence.

  • Regulate metabolic pathways: Interacting with glycolytic intermediates (e.g., glyceraldehyde-3-phosphate) as part of carbon metabolism .

Biochemical Assays

To study plsY activity, researchers may use:

  1. In vitro acyltransferase assays: Measure LPA formation using radiolabeled acyl-CoA and glycerol-3-phosphate.

  2. Membrane lipid profiling: Analyze lipid composition in F. tularensis mutants lacking plsY.

Comparative Analysis with Related Enzymes

EnzymeFunctionRelevance to F. tularensis
GapA (GAPDH)Glycolytic enzyme; extracellular localization Complementary role in carbon metabolism
DsbA (Disulfide bond isomerase)Required for intracellular replication Unrelated to lipid biosynthesis
FopA (Outer membrane protein)Induces protective immune responses Distinct from plsY’s metabolic role

Gaps and Future Directions

  • Functional studies: No published data on plsY’s enzymatic activity or knockout phenotypes.

  • Structural biology: Crystallography or cryo-EM could elucidate substrate-binding mechanisms.

  • Host interaction: Investigate whether plsY modulates host lipid metabolism during infection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; FTA_0889; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Target Names
plsY
Target Protein Sequence
MNFLNFSILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGKVPAAITLI FDILKGLVPVVIAKVLTGNDFITACTALYAILGHIFPIFFGFKGGKGVATLIGTLFGFSW ILGLIFVITWLCVAIITRYSSLSALVATVIASFSVIFTSDLQVAAPFLIIAIIILVKHKG NIQRLISGQESKIGDKAKAKNDSN
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: fta:FTA_0889

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do researchers isolate and purify recombinant F. tularensis proteins for functional studies?

The isolation and purification of recombinant F. tularensis proteins typically involves:

  • Gene cloning strategy: Primer pairs are designed based on genomic sequences for amplification of target genes from isolated F. tularensis genomic DNA .

  • Expression system selection: Escherichia coli is commonly used as a heterologous expression host. For example, acid phosphatase from F. tularensis has been successfully expressed in E. coli, yielding recombinant enzyme with attributes equivalent to the native enzyme .

  • Purification approach: Researchers typically employ His-tag affinity chromatography for initial purification, followed by additional steps such as ion exchange or size exclusion chromatography to achieve high purity.

  • Quality control: Verification includes SDS-PAGE analysis, Western blotting, and functional assays to confirm that the recombinant protein retains native properties and activity .

For membrane proteins like plsY, additional considerations include the use of appropriate detergents during extraction and purification to maintain protein solubility and function.

What expression systems are most effective for producing functional F. tularensis recombinant proteins?

E. coli expression systems have been successfully used for various F. tularensis proteins. Key considerations include:

  • Promoter selection: The F. tularensis groES promoter has been effectively used to drive gene expression in heterologous systems .

  • Codon optimization: Adjusting codon usage to match the expression host can improve yields.

  • Signal peptide evaluation: For exported proteins, maintaining the native signal peptide may be important. For instance, catalase-peroxidase (KatG) from F. tularensis exhibits a functional signal peptide that facilitates export even in recombinant E. coli host cells .

  • Post-translational consideration: Some F. tularensis proteins undergo post-translational modifications, such as the multiple modifications observed on the universal stress protein (Usp), including lysine acetylation and glutamine polyamination .

What strategies can researchers employ to characterize post-translational modifications of recombinant F. tularensis proteins?

Post-translational modifications (PTMs) can significantly impact protein function. For characterizing PTMs in F. tularensis proteins:

  • Mass spectrometry analysis: This technique has revealed PTMs on F. tularensis proteins. For example, recombinant F. tularensis universal stress protein (rUsp/His6) exhibited an apparent molecular weight of 33 kDa despite a predicted 30 kDa, with mass spectrometry confirming multiple PTMs including lysine acetylation and glutamine polyamination .

  • Comparative analysis: Comparing molecular weights of recombinant versus native proteins can indicate potential PTMs. Discrepancies between predicted and observed weights should be investigated further.

  • Site-directed mutagenesis: Mutating specific residues suspected of undergoing PTMs can help determine their functional significance.

  • Specific enzymatic treatments: Using deacetylases or other modification-removing enzymes can confirm the presence and functional role of specific PTMs.

How can transposon mutagenesis be applied to study F. tularensis protein function in vivo?

Transposon mutagenesis is a powerful tool for studying gene function in F. tularensis:

  • Temperature-sensitive Tn5 delivery system: A specialized system has been developed for F. tularensis that enables generation of chromosomal reporter fusions with lacZ or luxCDABE. This system uses:

    • Hyperactive Tn5 transposase driven by the F. tularensis groES promoter

    • High-temperature selection (42°C) to recover bacteria with chromosomal Tn5 insertions

    • FLP recombination target (FRT) sequences that allow deletion of antibiotic resistance markers

  • Recovery rates: Approximately 0.1% of bacterial populations carrying the transposon delivery plasmid develop chromosomal insertions when subjected to high-temperature selection .

  • Insertion characteristics: Nucleotide sequence analysis confirms that insertions occur randomly throughout the chromosome, making this system suitable for creating saturating mutant libraries .

  • Reporter systems: The system can create chromosomal luxCDABE or lacZ transcriptional reporter fusions, enabling monitoring of gene expression under various conditions .

What approaches are recommended for studying membrane protein topology and localization in F. tularensis?

For investigating membrane protein topology and localization:

  • Bioinformatic prediction combined with experimental validation: Six independent bioinformatic analyses have been used to identify membrane proteins in F. tularensis, followed by experimental verification using recombinant proteins and polyclonal antisera as strategic probes .

  • Sucrose density gradient ultracentrifugation: This "gold standard" method has been adapted for separating F. tularensis outer membranes (OMs) and inner membranes (IMs). Notably, F. tularensis OMs typically migrate in sucrose gradients between densities of 1.17 and 1.20 g/ml, which differs from densities observed for other gram-negative bacteria (1.21 to 1.24 g/ml) .

  • Two-dimensional electrophoresis with mass spectrometric analysis: This approach has been effective for identifying immunogenic proteins in F. tularensis membrane fractions .

  • Recombinant expression with epitope tags: This allows detection and localization studies using tag-specific antibodies when native antibodies are unavailable.

  • Immunofluorescence microscopy: This can confirm subcellular localization patterns when combined with specific antibodies.

What experimental approaches can be used to assess the enzymatic activity of recombinant F. tularensis plsY?

For enzymatic characterization of recombinant plsY:

  • Substrate specificity assessment: Similar to studies with F. tularensis acid phosphatase, recombinant plsY should be tested with various substrates to determine its specificity profile .

  • pH optimum determination: Enzymatic assays should be conducted across a pH range to establish optimal conditions, as has been done for other F. tularensis enzymes .

  • Inhibitor sensitivity profiling: Testing sensitivity and resistance to various inhibitors helps characterize the enzyme's active site and can identify potential therapeutic targets .

  • Kinetic parameter determination: Measuring Km, Vmax, and catalytic efficiency under standardized conditions provides fundamental insights into enzyme function.

  • Activity comparison: Comparing the enzymatic properties of recombinant plsY with those of the native enzyme (if available) can verify that the recombinant form maintains physiologically relevant characteristics .

How does growth medium composition affect F. tularensis protein expression levels?

Growth medium composition significantly impacts F. tularensis protein expression:

  • Comparative expression analysis: Studies have shown differential gene expression when F. tularensis is grown on modified Mueller-Hinton (MMH) versus Chamberlain's defined medium (CDM) .

  • Virulence factor induction: Growth on CDM has been reported to result in:

    • Increased capsule production

    • Enhanced type IV pilus expression

    • General increase in virulence in mouse models

  • Monitoring approaches: Transcriptional reporter libraries using luxCDABE or lacZ fusions have successfully identified both established virulence genes and novel genes that may play roles in pathogenesis when comparing growth on different media .

  • Stress response correlation: The expression of certain proteins, such as Usp, remains consistently high under various stress conditions, including nutrient deprivation, low pH, and oxidative stress .

What is the relationship between F. tularensis stress response and membrane protein function?

The relationship between stress response and membrane proteins in F. tularensis reveals important aspects of bacterial adaptation:

  • Oxidative stress resistance: F. tularensis proteins like Usp play protective roles against oxidative stress. The deletion of usp results in impaired growth and recovery under paraquat-induced oxidative stress .

  • Transcriptional regulation: Stress response proteins can support the expression of key antioxidant defense genes. For example, Usp supports the expression of oxyR and katG in F. tularensis .

  • Environmental adaptation: Membrane proteins often function in sensing and responding to environmental changes. F. tularensis can survive under diverse environmental and host-induced stress conditions, with membrane components playing critical roles in this adaptation .

  • Protein half-life considerations: Some stress-response proteins display remarkable stability. For instance, F. tularensis usp mRNA has a half-life exceeding 30 minutes, with protein and transcript levels remaining consistently high under various stress conditions .

How do researchers address the challenges of protein solubility when working with recombinant membrane proteins like plsY?

Membrane proteins present unique challenges for recombinant expression:

  • Expression system optimization:

    • Using specialized E. coli strains designed for membrane protein expression

    • Testing different growth temperatures (often lower temperatures improve folding)

    • Employing fusion partners that enhance solubility

  • Extraction strategies:

    • Selection of appropriate detergents for solubilization

    • Screening different detergent:protein ratios

    • Implementing step-wise extraction protocols

  • Purification approaches:

    • Using detergent exchange during purification

    • Incorporating stabilizing agents in purification buffers

    • Considering native lipid addition to maintain function

  • Alternative expression formats:

    • Cell-free expression systems with lipid nanodiscs

    • Amphipol stabilization for structural studies

    • Expression as truncated soluble domains where appropriate

What techniques are available for analyzing protein-protein interactions involving F. tularensis membrane proteins?

For studying protein-protein interactions:

  • Co-immunoprecipitation: Using antibodies against the target protein to pull down interaction partners.

  • Bacterial two-hybrid systems: Adapted for membrane protein interactions.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interacting partners.

  • Pull-down assays: Using recombinant tagged proteins as bait to identify interaction partners from bacterial lysates.

  • Biolayer interferometry or surface plasmon resonance: For measuring binding kinetics between purified components.

  • Blue native PAGE: For preserving and analyzing multi-protein complexes.

How can structural information about F. tularensis plsY inform drug development efforts?

Structural characterization approaches that inform drug development include:

  • X-ray crystallography: Determining high-resolution structures of purified recombinant protein.

  • Cryo-electron microscopy: Especially useful for membrane proteins that are difficult to crystallize.

  • Structure-based drug design: Using structural data to identify potential binding pockets and design inhibitors.

  • Molecular docking studies: In silico screening of compound libraries against structural models.

  • Site-directed mutagenesis: Validating key residues identified in structural studies to confirm their importance for function and potential drug binding.

  • Fragment-based drug discovery: Testing small molecular fragments for binding to specific protein regions.

What statistical approaches are recommended for analyzing enzyme kinetics data from recombinant F. tularensis proteins?

For robust enzyme kinetics analysis:

  • Non-linear regression analysis: Rather than linear transformations (Lineweaver-Burk plots), non-linear regression directly fitting to the Michaelis-Menten equation provides more accurate parameter estimates.

  • Global fitting approaches: When analyzing inhibitor studies, global fitting of multiple datasets simultaneously improves parameter estimation.

  • Bootstrap resampling: This technique provides more realistic error estimates for kinetic parameters.

  • Model discrimination: Statistical tests to determine whether more complex kinetic models (substrate inhibition, allosteric effects) are justified by the data.

  • Replicate design considerations:

    • Minimum of three independent protein preparations

    • Technical replicates within each preparation

    • Controlling for batch effects in statistical analysis

How do researchers standardize and validate functional assays for F. tularensis enzymes?

Standardization and validation practices include:

  • Assay development controls:

    • Positive controls using well-characterized enzymes

    • Negative controls with heat-inactivated enzyme

    • Substrate-only and enzyme-only controls

  • Validation parameters:

    • Linearity assessment across concentration ranges

    • Precision determination (intra-day and inter-day)

    • Limit of detection and quantification establishment

    • Specificity confirmation through inhibitor studies

  • Reference standards:

    • Comparison to native enzyme when available

    • Use of commercial enzyme standards when applicable

    • Internal laboratory reference preparations

  • Assay robustness testing:

    • pH and buffer composition influence

    • Temperature sensitivity

    • Storage stability assessment

    • Freeze-thaw cycle impacts

Validation ParameterAcceptance CriteriaTypical Methodology
LinearityR² > 0.98Multiple substrate concentrations
PrecisionCV < 10%Replicate analyses
SpecificityActivity reduction > 90% with specific inhibitorsInhibitor studies
StabilityActivity retention > 85%Time-course studies
pH OptimumActivity > 50% of maximumpH range testing

What containment considerations must researchers address when working with recombinant F. tularensis proteins?

F. tularensis is classified as a category A select agent by the CDC, necessitating stringent safety protocols:

  • Biosafety level requirements:

    • Work with live F. tularensis requires BSL-3 facilities

    • Recombinant proteins may be handled at BSL-2 with appropriate risk assessment

    • Institutional biosafety committee approval is mandatory

  • Containment strategies:

    • Use of biological safety cabinets

    • Appropriate personal protective equipment

    • Validated decontamination procedures

  • Regulatory compliance:

    • Select agent registration requirements

    • Documentation and inventory control

    • Restricted personnel access

  • Alternative approaches:

    • Using attenuated strains like LVS for initial studies

    • Employing non-pathogenic heterologous expression systems

    • Developing cell-free experimental systems where applicable

How can researchers troubleshoot expression issues when working with F. tularensis membrane proteins?

Common expression challenges and solutions include:

  • Low expression levels:

    • Codon optimization for expression host

    • Testing different promoter systems

    • Using the F. tularensis groES promoter which has shown success

    • Optimizing induction conditions (temperature, inducer concentration)

  • Protein misfolding:

    • Co-expression with molecular chaperones

    • Incorporation of fusion partners

    • Expression at reduced temperatures (16-25°C)

    • Addition of specific lipids during expression

  • Proteolytic degradation:

    • Using protease-deficient expression strains

    • Addition of protease inhibitors during purification

    • Optimizing extraction and purification speed

  • Toxic effects on host cells:

    • Using tightly regulated inducible systems

    • Employing specialized expression strains

    • Testing cell-free expression systems

What strategies help overcome the challenges of producing sufficient quantities of functional recombinant F. tularensis proteins?

To achieve adequate protein yields:

  • Scale-up approaches:

    • Bioreactor cultivation with optimized parameters

    • High-density fermentation protocols

    • Fed-batch cultivation strategies

  • Purification optimization:

    • Multi-step chromatography protocols

    • High-capacity affinity resins

    • Automated purification systems

  • Stabilization strategies:

    • Buffer optimization screening

    • Addition of specific ligands or co-factors

    • Appropriate storage conditions validation

  • Expression enhancement:

    • Using strong, regulated promoters

    • Testing different affinity tags and fusion partners

    • Optimizing media composition based on known differential expression effects in F. tularensis

How might advanced structural biology techniques contribute to understanding F. tularensis plsY function?

Emerging structural biology approaches offer new opportunities:

  • Integrative structural biology:

    • Combining X-ray crystallography, cryo-EM, and NMR data

    • Small-angle X-ray scattering for studying conformational dynamics

    • Mass photometry for analyzing protein complexes

  • In situ structural studies:

    • Cryo-electron tomography of F. tularensis cells

    • Correlative light and electron microscopy

    • In-cell NMR spectroscopy

  • Time-resolved structural methods:

    • Time-resolved crystallography for capturing enzymatic intermediates

    • Temperature-jump studies coupled with structural analysis

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Computational approaches:

    • Molecular dynamics simulations of membrane-embedded plsY

    • Quantum mechanics/molecular mechanics studies of catalytic mechanisms

    • Deep learning-based structure prediction and validation

What emerging technologies show promise for studying F. tularensis protein function in host-pathogen interactions?

Cutting-edge approaches for host-pathogen studies include:

  • Advanced imaging techniques:

    • Super-resolution microscopy for localizing proteins during infection

    • Live-cell imaging with genetically encoded sensors

    • Correlative light and electron microscopy of infected cells

  • High-throughput functional genomics:

    • CRISPR interference/activation screening in host cells

    • Dual RNA-seq of host-pathogen interactions

    • Proteomics of purified pathogen-containing vacuoles

  • Organoid and tissue models:

    • 3D lung organoids for studying host-pathogen interactions

    • Organ-on-chip technologies for physiologically relevant models

    • Ex vivo tissue infection models

  • Single-cell analysis:

    • Single-cell RNA-seq of infected host populations

    • Mass cytometry for high-dimensional analysis

    • Spatial transcriptomics of infected tissues

How might inhibitors of F. tularensis plsY be evaluated for therapeutic potential?

Comprehensive evaluation of potential inhibitors includes:

  • Initial screening approaches:

    • Structure-based virtual screening

    • Fragment-based screening

    • High-throughput enzymatic assays

    • Phenotypic screening with bacterial growth inhibition

  • Mechanism validation:

    • Enzyme kinetics to determine inhibition mechanisms

    • Binding affinity measurements (ITC, SPR, MST)

    • Structural studies of enzyme-inhibitor complexes

    • Activity against mutant enzymes to confirm specificity

  • Cellular efficacy assessment:

    • Intracellular activity against F. tularensis in macrophages

    • Cytotoxicity evaluation in mammalian cells

    • Effect on bacterial membrane composition and integrity

    • Resistance development monitoring

  • In vivo evaluation pipeline:

    • Pharmacokinetic and pharmacodynamic profiling

    • Efficacy in animal models of tularemia

    • Combination studies with existing antibiotics

    • Safety and toxicity assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.