Recombinant Francisella tularensis subsp. holarctica Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Function of YidC in Bacteria

YidC is an essential insertase and chaperone in bacteria, facilitating the integration of membrane proteins into the cytoplasmic membrane. It can act independently or as part of the SecYEG translocon complex to insert both single-spanning and more complex polytopic membrane proteins . YidC's structure includes a coiled-coil domain and five transmembrane α-helices, forming a hydrophilic groove that aids in guiding hydrophilic segments of nascent polypeptides through the lipid bilayer .

Recombinant YidC Production

Recombinant YidC proteins are produced using various expression systems, such as mammalian cells, to study their function and potential applications. These proteins are often partial sequences due to the complexity of expressing full-length membrane proteins . The recombinant YidC from Francisella tularensis subsp. tularensis is available commercially, but specific information on the subsp. holarctica variant is scarce .

Research Findings and Applications

While specific research on recombinant Francisella tularensis subsp. holarctica YidC is limited, studies on YidC from other bacteria highlight its importance in membrane protein biogenesis. Understanding YidC's role could aid in developing novel therapeutic strategies targeting bacterial membrane proteins. For instance, disrupting YidC function could impair bacterial viability by preventing essential membrane protein insertion.

Data and Tables

Given the limited specific data on recombinant Francisella tularensis subsp. holarctica YidC, we can summarize general information about YidC and its role in bacteria:

FeatureDescription
FunctionEssential insertase and chaperone for membrane proteins.
StructureIncludes a coiled-coil domain and five transmembrane α-helices.
Role in BacteriaFacilitates the insertion and folding of membrane proteins.
Expression SystemsOften expressed in mammalian cells for research.
Potential ApplicationsTargeting YidC could disrupt bacterial membrane protein biogenesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; FTA_0192; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Target Names
yidC
Target Protein Sequence
MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNSHYDNADSSTNTDVTI TDAKSSLAKETNFSKYDNAKSITINTVVFKDVKVSLLDGAIISASLKDYSISLDDKTPMS LLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKIENSKQILTLTGSADGLQITRTYTFDD TKYNISVSQNIKNTTSAPVNVIVDDSFARDFDPAGDSFSLLNAHSYTFTGVAYSTAKDSF RKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQSTNAKIYYKNLNGDVFEAGA FTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNHIHS LVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETYKDDRQALGKKMM ELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPV LMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFASFPSGLVLYWLTNNLISISQQWI ITRHYQATHKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links

KEGG: fta:FTA_0192

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Francisella tularensis and why is it significant in research?

Francisella tularensis is a gram-negative bacterium that causes tularemia, a zoonotic disease that poses significant health risks to humans. It has been classified as a Tier 1 Select agent by the Centers for Disease Control and Prevention (CDC), highlighting its potential as a bioterrorism agent. The bacterium is particularly important in research due to the challenges associated with its timely diagnosis, primarily attributed to the non-specific nature of tularemia infections. Rapid, sensitive, and accurate detection methods are continuously being developed to reduce mortality rates associated with tularemia infections .

The pathogen can spread through various routes including arthropod bites, direct contact with infected animals, inhalation of contaminated aerosols, or ingestion of contaminated food or water. Due to its high virulence, low infectious dose, and potential for aerosolization, F. tularensis research requires specialized containment facilities and handling protocols.

What is YidC protein and what role does it play in bacterial membranes?

YidC is a universally conserved membrane protein that mediates the integration of membrane proteins into the cytoplasmic membrane of bacteria. This process occurs co-translationally, meaning that membrane proteins are inserted into the membrane as they are being synthesized by the ribosome. YidC can function either individually as a membrane protein insertase or in concert with the SecY complex .

The protein features a distinctive arrangement of five conserved transmembrane domains and includes a helical hairpin between transmembrane segment 2 (TM2) and TM3 on the cytoplasmic membrane surface. YidC plays a critical role in bacterial viability by facilitating the proper folding and insertion of membrane proteins that are essential for various cellular functions, including respiration, nutrient transport, and cell signaling .

What methods are used to identify Francisella tularensis in clinical samples?

Several laboratory methods are employed for identifying F. tularensis in clinical settings:

How can recombinant FopA protein from Francisella tularensis be expressed and purified?

The expression and purification of recombinant Outer Membrane Protein A (FopA) from F. tularensis involves several sophisticated techniques:

Expression Protocol:

  • Culture ExpiSf9™ cells at a density of 5 × 10⁶ cells/mL with ≥90% viability

  • Add ExpiSf™ Enhancer to the cell culture

  • After 18-24 hours, infect the cells with recombinant baculovirus stock at a multiplicity of infection (MOI) of 5

  • Harvest supernatants 120 hours post-infection via centrifugation at 4,000 rpm for 30 minutes

  • Filter the supernatant using a 0.22-μm bottle top vacuum filter

Purification Protocol:

  • Purify the recombinant FopA from filtered supernatants using a Complete™ His-Tag Purification Column equipped with NGC QUEST 100 Chromatography Systems

  • Elute the protein with 80mM imidazole PBS buffer

  • Dialyze the eluted protein in PBS (pH 7.4)

This baculovirus expression system offers advantages for membrane protein production including proper folding and post-translational modifications that may be critical for maintaining the native structure and function of FopA.

What techniques can be used to develop monoclonal antibodies against F. tularensis proteins?

The development of monoclonal antibodies against F. tularensis proteins, specifically FopA, involves several key steps:

  • Immunization: 5-week-old female BALB/c mice are immunized with recombinant FopA antigen produced using the baculovirus expression system described above.

  • Hybridoma Generation: Following immunization, hybridomas are generated through the fusion of B lymphocytes from immunized mice with myeloma cells.

  • Screening: The resulting hybridoma clones are screened using ELISA to identify those producing monoclonal antibodies with high specificity and affinity for recombinant FopA.

  • Genetic Characterization: The cDNA of positive hybridoma cells is synthesized using a random hexamer primer, and the variable regions of heavy and light chains (VH and VL) are amplified using PCR with appropriate primer sets.

  • Ethical Considerations: All animal procedures must be reviewed and authorized by appropriate ethics committees (e.g., IACUC approval) .

This methodological approach allows researchers to develop highly specific antibodies that can be used in various diagnostic applications, including sandwich immunoassays for the detection of F. tularensis.

How sensitive are immunoassay methods for detecting F. tularensis proteins in various matrices?

Recent research has demonstrated that sandwich immunoassays utilizing anti-FopA monoclonal antibodies provide exceptional sensitivity for detecting F. tularensis proteins across diverse environmental and biological matrices.

A study showed that recombinant FopA protein could be detected at concentrations ranging from 0.3–20 ng/mL when diluted in various matrices including PBS, skim milk, human serum, bovine serum albumin (BSA), mouse urine, and soil water. The limits of detection (LoD) established through linear regression analyses were remarkably consistent across different matrices :

MatrixLimit of Detection (ng/mL)
3% Human Serum0.066
3% Bovine Serum Albumin0.074
Mouse Urine0.071
Soil Water0.067

These data indicate that the immunoassay method can detect FopA without significant interference from matrix components, making it suitable for identifying pathogens in various environments and clinical samples. This consistency across matrices is particularly valuable for field applications and clinical diagnostics where sample types may vary considerably .

What is the structural model of YidC and how was it determined?

The structural model of YidC was developed through a multidisciplinary approach combining several advanced techniques:

  • Evolutionary Co-variation Analysis: This computational method identifies pairs of amino acids that have co-evolved, suggesting spatial proximity in the folded protein.

  • Lipid-versus-Protein-Exposure Analysis: This approach predicts which protein regions are embedded in the lipid bilayer versus those exposed to the aqueous environment.

  • Molecular Dynamics Simulations: These simulations test the stability and biochemical properties of the proposed model in a simulated bacterial membrane environment.

The resulting model reveals a distinctive arrangement of five conserved transmembrane domains (TM1-TM5) with a helical hairpin between TM2 and TM3 positioned on the cytoplasmic membrane surface. The model shows that while the five transmembrane helices form a rigid protein core, the polar loop regions exhibit mobility on the membrane surface .

Analysis of inter-residue interactions within the transmembrane region revealed that hydrophobic residues on the exterior of the TM bundle stabilize interactions with apolar lipid tails, while the core is stabilized through both short and long-range interactions between the five helices. Residues toward the cytoplasmic side are primarily polar or charged and engaged in electrostatic interactions, whereas residues on the periplasmic side are primarily aromatic and involved in stacking and other nonpolar dispersion interactions .

How does YidC interact with ribosomes during membrane protein insertion?

Cryo-electron microscopy studies of YidC-ribosome complexes have provided detailed insights into how this protein facilitates co-translational membrane protein insertion:

  • YidC binds directly to the ribosomal exit site, where nascent polypeptide chains emerge.

  • A single copy of YidC interacts with the ribosome through specific amino acid residues that contact the ribosomal RNA and proteins around the tunnel exit.

  • During insertion, the YidC protein creates a site for membrane protein insertion at the YidC protein-lipid interface.

  • The transmembrane segments of substrate proteins (like FOc) have been observed to make contact with TM3 of YidC, as confirmed by crosslinking studies.

  • The transmembrane helix of the nascent chain aligns with the ribosomal exit tunnel and is positioned near TM3 of YidC, which appears to guide the insertion process .

These structural insights suggest a mechanism where YidC receives the nascent membrane protein directly from the ribosome and facilitates its lateral movement into the lipid bilayer, ensuring proper folding and orientation in the process.

What are the effects of specific mutations on YidC function?

In vivo complementation assays have revealed that specific residues are critical for YidC function:

  • Critical Residues:

    • T362 in transmembrane helix 2 (TM2)

    • Y517 in transmembrane helix 6 (TM6)

    Both residues are positioned at the same height in the membrane, and alanine mutations at these positions completely inactivate YidC despite stable expression of the mutant proteins .

  • Residues with Intermediate Effects:

    • F433

    • M471

    • F505

    Alanine mutations at these positions, which are located close to the critical T362/Y517 pair, result in partial loss of function .

  • Residues with No Significant Effect:
    Residues positioned farther from the T362/Y517 pair do not significantly impact YidC function when mutated to alanine .

These findings indicate that specific interactions within the transmembrane region of YidC are essential for its membrane protein insertase activity, with the T362/Y517 pair potentially forming a crucial interaction site for substrate recognition or binding.

What novel interacting partners of YidC have been discovered recently?

Recent research has identified YibN as a previously uncharacterized but bona fide interactor of YidC. This discovery was made using BioID methodology, which probes the protein environment of YidC in vivo. YibN is an inner membrane protein that appears to have functional implications in membrane protein insertion and/or folding .

Transmission electron microscopy studies have revealed that YibN production is associated with significant morphological changes in bacterial membranes, including membrane proliferation, circumvolutions, and the formation of multilayered structures, primarily at the level of the bacteria's inner membrane. These observations suggest that YibN may play a role in membrane remodeling or organization in conjunction with YidC .

The identification of this novel interaction partner opens new avenues for understanding the broader molecular network involved in membrane protein biogenesis and the potential regulatory mechanisms that control YidC activity.

How can researchers integrate structural and functional studies of YidC to advance membrane protein research?

Advancing membrane protein research through integrated studies of YidC requires a multifaceted approach:

  • Combining Structural Biology with Functional Assays:
    Researchers should correlate high-resolution structural data (from cryo-EM or X-ray crystallography) with functional assays (such as complementation tests or in vitro reconstitution) to understand structure-function relationships. This approach has successfully identified critical residues like T362 and Y517 that are essential for YidC activity .

  • Systems Biology Approaches:
    Techniques like BioID, which identified YibN as a YidC interactor, can reveal the broader protein interaction network of YidC, providing insights into its regulation and additional functions .

  • Comparative Studies Across Species:
    The YidC/Oxa1/Alb3 family is conserved across bacteria, mitochondria, and chloroplasts. Comparative studies can reveal evolutionarily conserved mechanisms and species-specific adaptations in membrane protein insertion.

  • Translation to Biomedical Applications:
    Understanding YidC function in pathogenic bacteria like F. tularensis could lead to novel antimicrobial strategies targeting membrane protein insertion, potentially addressing the challenge of antibiotic resistance.

By integrating these approaches, researchers can develop a comprehensive understanding of membrane protein insertion mechanisms, potentially leading to innovations in both basic science and applied fields such as synthetic biology and therapeutic development.

What biosafety considerations must be addressed when working with F. tularensis?

Research involving F. tularensis requires strict adherence to biosafety protocols due to its classification as a Tier 1 Select Agent by the CDC:

  • Containment Requirements:

    • All F. tularensis culturing and sample handling must be conducted in a Biosafety Level 3 (BSL-3) laboratory

    • Work should be performed in certified biological safety cabinets

    • Negative air pressure rooms with HEPA filtration are required

  • Personnel Protection:

    • Researchers must use appropriate personal protective equipment including respiratory protection

    • Vaccination should be considered for laboratory personnel

    • Regular health monitoring and reporting of potential exposures is essential

  • Strain Considerations:

    • While F. tularensis subsp. holarctica (Type B) is less virulent than subsp. tularensis (Type A), both require BSL-3 containment

    • Attenuated strains may be handled at BSL-2 with appropriate institutional approvals

  • Regulatory Compliance:

    • Research requires approval from institutional biosafety committees

    • Registration with appropriate national authorities is mandatory

    • Material transfer agreements must be in place for strain sharing

These stringent requirements significantly impact experimental design and feasibility, making recombinant approaches using specific proteins (rather than whole organisms) an attractive alternative for certain research questions.

How can researchers optimize expression systems for membrane proteins like YidC?

Optimizing expression systems for membrane proteins presents unique challenges that researchers must address through methodical approaches:

  • Expression Host Selection:

    • E. coli: Commonly used but may not provide optimal folding for complex membrane proteins

    • Insect cells (e.g., ExpiSf9™): Offer more sophisticated folding machinery and post-translational modifications

    • Cell-free systems: Allow direct manipulation of the membrane environment but at lower yields

  • Vector Design Considerations:

    • Promoter strength must be calibrated (too strong can lead to aggregation)

    • Fusion tags (His, Strep, etc.) should be positioned to minimize interference with folding

    • Inclusion of ribosome binding sites optimized for the expression host

  • Induction Parameters:

    • Temperature: Lower temperatures (16-25°C) often improve folding

    • Induction timing: Optimal cell density prior to induction (e.g., 5 × 10⁶ cells/mL for insect cells)

    • Induction duration: Extended expression periods may be necessary (e.g., 120 hours post-infection for baculovirus systems)

  • Solubilization and Purification:

    • Detergent selection is critical (must maintain protein structure while extracting from membrane)

    • Gradient purification approaches to separate properly folded protein from aggregates

    • Validation of structural integrity through functional assays

By systematically optimizing these parameters, researchers can improve the yield and quality of membrane proteins for structural and functional studies, accelerating research in this challenging field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.