Recombinant Francisella tularensis subsp. holarctica Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Francisella tularensis subsp. holarctica prolipoprotein diacylglyceryl transferase (Lgt) is a genetically engineered form of the enzyme responsible for the first step in bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, forming a thioether bond . This modification is essential for anchoring lipoproteins to the bacterial membrane and directing their sorting via the Lol pathway .

Recombinant Production Methods

Recombinant Lgt is typically produced via heterologous expression in Escherichia coli using plasmid systems such as pET15b or pET22b with histidine tags for purification . For example:

  • Cloning: The lgt gene is amplified from F. tularensis subsp. holarctica and inserted into expression vectors under inducible promoters (e.g., T7) .

  • Purification: Nickel-affinity chromatography isolates the enzyme, followed by biochemical validation using radiolabeled substrates or mass spectrometry .

4.1. Role in Pathogenesis

  • Lgt-processed lipoproteins, such as Tul4A (LpnA), are critical for OM integrity and immune evasion in F. tularensis .

  • Deletion of lgt disrupts lipoprotein sorting, increasing susceptibility to rifampin and serum killing .

4.2. Antibacterial Target Validation

  • Pharmacological inhibition of Lgt disrupts OM stability and sensitizes bacteria to host defenses .

  • Unlike downstream lipoprotein-processing enzymes (e.g., Lnt), Lgt inhibition cannot be rescued by deleting non-essential lipoproteins like lpp, highlighting its non-redundant role .

Table 2: Comparative Essentiality of Lipoprotein Processing Enzymes

EnzymeGeneEssential in F. tularensis?Rescue Pathway Available?
LgtlgtYesNo
LntlntNoModified LolABC system

Challenges and Future Directions

  • Structural studies: No crystal structure of Francisella Lgt exists, limiting rational drug design .

  • Host-specific adaptations: Francisella Lgt exhibits unique substrate recognition compared to E. coli, necessitating species-specific inhibitor development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; FTA_0756; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Target Names
lgt
Target Protein Sequence
MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFY VALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFIGVLIAFALFARKIGAN FFDLGEFVAPVIPIGLGAGRIGNFINGELLGKVTDSPLGMVFPTGGPLPRYPSQLFEFFF EGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGYARFICEFFRQPDPQYGYIFFNWMTMGQI LSIPMILLGAVILIAVFIKTRKNKCENI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: fta:FTA_0756

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Francisella tularensis subsp. holarctica and its significance in research?

Francisella tularensis subsp. holarctica is a moderately virulent (type B) subspecies of F. tularensis, a facultative intracellular bacterium that causes tularemia. This subspecies is widely distributed throughout the Northern hemisphere and can infect hundreds of different vertebrates and invertebrates . The Live Vaccine Strain (LVS) used in research and previously in vaccination is an attenuated variant of F. tularensis subsp. holarctica . This subspecies is significant in research due to its reduced virulence compared to subsp. tularensis (type A), making it safer to work with while still allowing for the study of pathogenic mechanisms relevant to human disease.

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in bacterial systems?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in bacterial lipoprotein biosynthesis pathways. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipoprotein signal sequence. This modification is essential for proper lipoprotein processing and anchoring to the bacterial membrane. In F. tularensis, lipoproteins have been implicated in pathogenesis, as studies have shown TLR2 (a receptor for lipoproteins) plays an important role in the host response to Francisella infection .

How do lipoproteins contribute to F. tularensis pathogenicity?

Lipoproteins in F. tularensis contribute significantly to pathogenicity through several mechanisms:

  • Immune stimulation: F. tularensis lipoproteins interact with Toll-like receptor 2 (TLR2) on host cells, triggering inflammatory responses .

  • Virulence regulation: Unlike the lipopolysaccharide (LPS) of F. tularensis, which possesses low bioactivity and doesn't stimulate production of inflammatory mediators like TNF-α, interferon-γ, or interleukins in murine macrophages , lipoproteins appear to be important components capable of initiating inflammation.

  • Pathogenesis: Recent findings have implicated TLR2 as important in the host response to infection with Francisella, suggesting that lipoproteins processed by lgt may be critical virulence determinants .

What bacterial processes are affected by lgt-mediated protein modification?

Lgt-mediated modifications affect multiple bacterial processes including:

  • Membrane integrity: Properly processed lipoproteins contribute to membrane structure and stability

  • Nutrient acquisition: Many lipoproteins function as substrate-binding components of ABC transporters

  • Cell wall maintenance: Several lipoproteins are involved in peptidoglycan synthesis and remodeling

  • Stress responses: Lipoproteins can function in sensing and responding to environmental stressors

  • Host-pathogen interactions: Surface-exposed lipoproteins can mediate adhesion to host cells and evasion of immune responses

What are the optimal conditions for recombinant expression of F. tularensis lgt?

Based on established protocols for recombinant expression of F. tularensis proteins, the following methodology is recommended:

  • Vector selection: pET expression systems have proven effective for F. tularensis proteins. For lgt specifically, pET15b for N-terminal His-tagged constructs or pET22b for C-terminal His-tagged constructs are recommended .

  • Host strain selection: E. coli BL21(DE3) or Rosetta strains are suitable hosts for expression of F. tularensis proteins .

  • Gene amplification and cloning procedure:

    • Isolate genomic DNA from F. tularensis subsp. holarctica using phenol-chloroform extraction

    • Design primers with appropriate restriction sites (typically NdeI and BamHI/XhoI)

    • Amplify the lgt gene by PCR and clone into the selected expression vector

    • Transform into E. coli expression host

  • Expression conditions: Optimize through testing various parameters:

    • IPTG concentration: 0.1-1.0 mM

    • Induction temperature: 16-30°C (lower temperatures may improve solubility)

    • Induction time: 4-16 hours

    • Media: LB or defined media supplemented with appropriate antibiotics

What purification strategies are most effective for recombinant F. tularensis lgt?

Based on successful purification of other F. tularensis recombinant proteins, the following purification strategy is recommended:

  • Cell lysis: Sonication or French press in buffer containing:

    • 50 mM Tris-HCl (pH 8.0)

    • 300 mM NaCl

    • 10 mM imidazole

    • Protease inhibitor cocktail

  • Initial purification: Immobilized metal affinity chromatography (IMAC)

    • Ni-NTA resin for His-tagged constructs

    • Gradient elution with increasing imidazole concentration (20-500 mM)

  • Secondary purification: Size exclusion chromatography

    • Superdex 200 column in buffer containing:

      • 20 mM Tris-HCl (pH 7.5)

      • 150 mM NaCl

  • Detergent considerations: As lgt is a membrane-associated enzyme, addition of mild detergents may be necessary:

    • 0.1% n-dodecyl-β-D-maltoside (DDM)

    • 0.5% CHAPS

    • 0.1% Triton X-100

  • Quality control: Assess protein purity by SDS-PAGE and Western blotting with anti-His antibodies, similar to the approach used for other F. tularensis recombinant proteins .

How can genetic manipulation techniques be applied to study lgt function in F. tularensis?

Gene deletion through allelic exchange has been successfully used to create knockout strains in F. tularensis LVS. The following methodology can be applied to study lgt function:

  • Construction of deletion plasmid:

    • Create a plasmid containing:

      • Deleted version of lgt gene (typically with in-frame deletion)

      • sacB gene (provides sucrose sensitivity for counter-selection)

      • Chloramphenicol resistance cassette

    • Example: pPV-based vectors have been successfully used for F. tularensis gene deletion

  • Conjugation and selection process:

    • Transform E. coli with the deletion plasmid

    • Perform conjugation between transformed E. coli and F. tularensis LVS

    • Select for primary recombinants on chloramphenicol-containing media

    • Counter-select on sucrose-containing media to identify double recombinants

  • Verification of deletion:

    • PCR analysis with primers flanking the deleted region

    • Sequencing of the genomic region

    • Western blot analysis to confirm absence of protein expression

    • Phenotypic characterization of the mutant strain

  • Complementation studies:

    • Create a complementation plasmid containing the wild-type lgt gene

    • Transform the deletion mutant with this plasmid

    • Assess restoration of phenotype to validate gene function

What experimental approaches can be used to assess the impact of lgt mutation on F. tularensis virulence?

Multiple experimental approaches can be employed to assess virulence impacts:

  • In vitro cellular infection models:

    • Human macrophage infection model: Compare wild-type and Δlgt mutant strains for:

      • Intracellular replication rates

      • Phagosomal escape efficiency

      • Cytokine/chemokine induction profiles

    • Acanthamoeba castellanii infection model: F. tularensis has shown resistance to killing by this amoeba, which may be relevant to environmental persistence

  • Immunological assays:

    • Streptolysin O treatment of infected macrophages to assess intracellular protein release

    • Measurement of inflammatory mediator production (TNF-α, IFN-γ, IL-12, etc.)

    • TLR2 activation assays to assess lipoprotein recognition by innate immune receptors

  • Animal infection models:

    • Mouse model of tularemia using various routes of infection:

      • Intradermal

      • Intranasal

      • Intraperitoneal

    • Parameters to assess:

      • Survival rates and time to death

      • Bacterial burden in tissues

      • Histopathological changes

      • Immune response profiles

  • Comparative proteomics:

    • 2D-PAGE analysis of wild-type vs. Δlgt mutant membrane fractions

    • Mass spectrometry identification of differentially processed proteins

    • Western blot analysis of specific lipoprotein processing

How does the LPS structure of F. tularensis interact with lgt-processed lipoproteins?

F. tularensis possesses an atypical LPS with unusual structural features that contribute to its low bioactivity:

What considerations are important when designing experiments to study recombinant F. tularensis lgt?

When designing experiments involving recombinant F. tularensis lgt, researchers should consider:

  • Biosafety considerations:

    • F. tularensis is a Tier 1 select agent requiring appropriate containment facilities

    • Using the attenuated LVS strain reduces biosafety requirements

    • Recombinant work should be conducted under appropriate biosafety conditions

  • Expression system optimization:

    • Multiple expression constructs should be tested (N-terminal vs. C-terminal tags)

    • Codon optimization may improve expression in E. coli

    • Expression conditions should be systematically optimized through factorial design

  • Protein activity assessment:

    • Development of in vitro assays to measure enzymatic activity

    • Structural studies to confirm proper folding

    • Functional complementation experiments in deletion mutants

  • Experimental controls:

    • Include enzymatically inactive mutants (e.g., active site mutants)

    • Use known lipoproteins from F. tularensis as substrates

    • Include controls for non-specific effects of protein overexpression

How can optimal experimental design principles be applied to F. tularensis research?

Modern experimental design principles can significantly enhance F. tularensis research:

  • Decision theoretic optimal experimental design approach:

    • Select optimal experimental settings to maximize expected return quantified through a utility function

    • Implement "design windows" or "sampling windows" when specific design points cannot be sampled

  • Sequential design approach for big data analysis:

    • Start with a small initial subset of data

    • Use information from this subset to inform further data collection

    • This approach has shown to require roughly half the sample size compared to random sampling while achieving similar statistical power

  • Computational optimization in experimental design:

    • Apply Monte Carlo methods to approximate integrals when calculating expected utility

    • Use Kullback-Leibler divergence between prior and posterior as a utility function

Design ApproachSample Size EfficiencyComputational DemandApplicability to F. tularensis Research
Random SamplingLowLowSimple implementation
Sequential DesignHighModerateEfficient for scarce/costly samples
Optimal DesignHighestHighBest for complex experimental questions

What are the challenges in developing enzymatic assays for recombinant F. tularensis lgt?

Developing enzymatic assays for lgt activity presents several challenges:

  • Substrate preparation:

    • Requires synthesis or isolation of appropriate prolipoprotein substrates

    • May need radioactively labeled or fluorescently tagged substrates

    • Ensuring substrate proteins maintain native conformations

  • Reaction conditions optimization:

    • Buffer composition (pH, ionic strength)

    • Detergent selection and concentration

    • Temperature and time course optimization

    • Cofactor requirements (metal ions, etc.)

  • Detection methods:

    • Direct measurement of diacylglyceryl transfer

    • Indirect measurement through coupled reactions

    • Mass spectrometry to detect modified peptides

    • Gel-shift assays for modified vs. unmodified proteins

  • Controls and validation:

    • Inclusion of known lgt inhibitors

    • Comparison with enzymatically inactive mutants

    • Cross-validation with multiple detection methods

How should researchers interpret contradictory results in F. tularensis lipoprotein research?

When facing contradictory results in F. tularensis lipoprotein research, consider the following approach:

  • Strain variation considerations:

    • Different subspecies (tularensis vs. holarctica) may yield different results

    • Laboratory-adapted strains like LVS may differ from clinical isolates

    • Recent clinical isolates (RCI) have shown different protein expression profiles compared to laboratory strains

  • Methodological differences assessment:

    • Cell culture models (macrophages vs. dendritic cells) may yield different results

    • In vitro vs. in vivo studies often show discrepancies

    • Differences in protein preparation methods may affect functional outcomes

  • Technical validation steps:

    • Repeat experiments with standardized protocols

    • Use multiple detection methods

    • Include appropriate positive and negative controls

    • Assess reproducibility across different laboratories

  • Integrated data analysis:

    • Combine results from multiple approaches (genomics, proteomics, functional assays)

    • Use statistical methods appropriate for the specific data types

    • Consider Bayesian approaches to reconcile conflicting data

What statistical approaches are most appropriate for analyzing F. tularensis virulence data?

For analyzing F. tularensis virulence data, especially when comparing wild-type and lgt mutant strains:

  • Survival analysis:

    • Kaplan-Meier survival curves for animal infection experiments

    • Log-rank test for comparing survival between groups

    • Cox proportional hazards model for multivariable analysis

  • Bacterial burden analysis:

    • Transformation of CFU data (log10) to achieve normal distribution

    • ANOVA or t-tests for comparing bacterial loads between groups

    • Non-parametric tests (Mann-Whitney) for non-normally distributed data

  • Gene expression data:

    • Multiple testing correction for high-throughput data

    • Pathway enrichment analysis for biological interpretation

    • Principal component analysis for dimensionality reduction

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Blocking and randomization to control for confounding variables

    • Application of optimal experimental design principles as described in point 3.2

How can researchers effectively combine data from multiple experimental approaches studying F. tularensis lgt?

Effective strategies for integrating multiple data types include:

  • Meta-analysis approaches:

    • Standardize effect sizes across different experimental modalities

    • Weight results based on sample size and experimental rigor

    • Assess consistency across experiments using heterogeneity statistics

  • Systems biology integration:

    • Network analysis to identify connections between different experimental results

    • Pathway mapping to place findings in biological context

    • Mathematical modeling to reconcile diverse data types

  • Bayesian framework application:

    • Use prior knowledge to inform interpretation of new data

    • Update beliefs based on accumulating evidence

    • Properly weight conflicting results based on experimental quality

  • Data visualization techniques:

    • Integrated visualization of multiple data types

    • Interactive dashboards for exploring complex datasets

    • Clear graphical representation of areas of agreement and disagreement

What are the most promising avenues for therapeutic targeting of F. tularensis lgt?

Several promising therapeutic approaches targeting lgt include:

  • Small molecule inhibitor development:

    • Structure-based design of specific lgt inhibitors

    • High-throughput screening of compound libraries

    • Repurposing of existing antibiotics that may affect lipoprotein processing

  • Immunomodulatory approaches:

    • Targeting the TLR2-lipoprotein interaction to modify host response

    • Developing vaccines based on lgt-processed lipoproteins

    • Combination therapies targeting both bacterial replication and host response

  • Novel delivery systems:

    • Nanoparticle-mediated delivery of lgt inhibitors

    • Targeted delivery to macrophages, the primary site of F. tularensis replication

    • Sustained release formulations for improved pharmacokinetics

  • Combination therapy strategies:

    • Synergistic combinations of lgt inhibitors with conventional antibiotics

    • Multi-target approaches addressing multiple bacterial virulence pathways

    • Host-directed therapies combined with direct antimicrobials

How might advances in structural biology enhance our understanding of F. tularensis lgt?

Advances in structural biology offer several opportunities:

  • Structural determination techniques:

    • X-ray crystallography of purified recombinant lgt

    • Cryo-electron microscopy for membrane-associated complexes

    • NMR studies of protein-substrate interactions

    • Molecular dynamics simulations to understand conformational changes

  • Structure-function insights:

    • Identification of catalytic residues and mechanism

    • Substrate binding pocket characterization

    • Conformational changes during catalysis

    • Species-specific structural features

  • Drug design applications:

    • Structure-based virtual screening

    • Fragment-based drug discovery

    • Structure-activity relationship studies

    • Rational design of selective inhibitors

  • Protein engineering possibilities:

    • Creation of catalytically inactive variants for structural studies

    • Engineering substrate specificity

    • Development of biosensors based on lgt

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.