Recombinant Francisella tularensis subsp. holarctica Protein CrcB homolog (crcB)

What is the Francisella tularensis CrcB homolog protein and what is its known function?

The CrcB homolog protein in Francisella tularensis is a membrane protein that appears to be involved in ion transport, particularly fluoride ion efflux. The protein contains multiple transmembrane domains with a characteristic structure consisting of a number of membrane-spanning regions. According to the amino acid sequence data, the full-length protein consists of 130 amino acids with multiple hydrophobic regions consistent with its membrane localization .

The protein sequence (MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVIL GFYIVMGVYK) indicates a highly hydrophobic structure typical of integral membrane proteins . While the exact function of CrcB in F. tularensis has not been fully characterized, homologs in other bacterial species function as fluoride channels that protect bacteria from environmental fluoride toxicity.

How does the genetic context of the crcB gene contribute to its regulation in F. tularensis?

The crcB gene in F. tularensis subsp. holarctica is identified as FTT_0260 in the genomic context . Based on the genomic analysis of F. tularensis subsp. holarctica strain 12T0050, which represents a high-quality circular genome sequence, the genetic context surrounding regulatory elements like the origin of replication (oriC) is unique to the Francisella genus .

The genome of F. tularensis subsp. holarctica contains specific DnaA box sequences that differ from other bacteria, with two boxes having the identical sequence tgtggataa, which appears to be characteristic for all Francisella species . This genetic context may influence the regulation of genes including crcB. Additionally, the GC content of the genome (32.2%) creates a unique environment for gene expression and regulation . The extensive methylation patterns observed in the genome (with more than 150,000 methylation sites detected) also likely play a significant role in gene regulation, potentially including the crcB gene .

What expression systems are most effective for producing recombinant CrcB protein?

For recombinant production of F. tularensis CrcB homolog protein, researchers typically employ E. coli-based expression systems with specialized modifications to accommodate membrane proteins. The highly hydrophobic nature of CrcB (as evident from its amino acid sequence) necessitates expression strategies that prevent protein aggregation and facilitate proper membrane insertion .

Recommended expression methodology:

• Vector selection: Vectors containing tightly regulated promoters (T7 or arabinose-inducible) with fusion tags that enhance solubility (MBP, SUMO) or facilitate purification (His-tag)

• Host strains: E. coli strains optimized for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3)

• Growth conditions: Lower temperatures (16-20°C) post-induction to slow protein synthesis and allow proper folding

• Detergent screening: Systematic testing of detergents for efficient extraction (typical starting points include DDM, LDAO, and Triton X-100)

The recombinant protein produced for analytical applications is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage to maintain stability .

How does DNA methylation influence CrcB expression and function in F. tularensis?

DNA methylation appears to be pervasive in F. tularensis subsp. holarctica, with significant implications for gene expression regulation. The analysis of strain 12T0050_FLI revealed more than 150,000 methylation sites throughout the genome, with 12-40% of these sites being methylated . This extensive methylation pattern involves several types of DNA modifications including N6-methyl-adenosine (m6A), N4-methyl-cytosine (m4C), and N5-methyl-cytosine (m5C) .

Previous research has indicated that unmethylated CpG motifs in F. tularensis DNA trigger B-cell activation, whereas methylated DNA does not produce this response . This suggests that DNA methylation plays a critical role in the pathogen's stealth mechanisms within host macrophages .

For the crcB gene specifically, methylation likely influences its expression patterns during different phases of infection. The single-molecule real-time (SMRT) sequencing data shows strand-specific methylation patterns across the genome, which would affect transcriptional regulation of genes including crcB . While the specific methylation profile of the crcB promoter region is not detailed in the available data, the genome-wide methylation analysis provides a framework for understanding how this epigenetic mechanism might control CrcB production during host-pathogen interactions.

What structural and functional differences exist between CrcB homologs in different F. tularensis subspecies?

Comparative analysis between F. tularensis subspecies reveals subtle but potentially significant differences in the CrcB homolog protein. The search results primarily describe CrcB from F. tularensis subsp. tularensis (strain SCHU S4) and provide genomic data for F. tularensis subsp. holarctica .

The highly specialized nature of F. tularensis as a successful pathogen that appears to have reached an evolutionary "dead end" (similar to Mycobacterium leprae and Clostridium chauvoei) supports the hypothesis that functional proteins like CrcB may be highly optimized and conserved across subspecies .

What are the optimal experimental conditions for functional characterization of recombinant CrcB protein?

For functional characterization of recombinant F. tularensis CrcB protein, researchers should consider the following experimental conditions and methodological approaches:

Table 1: Optimal Conditions for CrcB Functional Assays

Functional Assay Methodologies:

• Fluoride ion transport assays: Liposome-reconstituted protein with fluoride-sensitive probes (PBFI or fluoride-selective electrodes)

• Patch-clamp electrophysiology: For single-channel conductance measurements

• Isothermal titration calorimetry (ITC): To determine binding affinities for fluoride and other potential substrates

• Thermal shift assays: To assess protein stability under different conditions

• In vivo complementation studies: Using F. tularensis crcB knockout mutants to assess functional complementation by recombinant protein

For structural studies, the protein should be purified in detergent micelles or nanodiscs, then subjected to crystallization trials or cryo-electron microscopy. Based on the protein's size (130 amino acids) and hydrophobic nature, obtaining diffraction-quality crystals may be challenging, making cryo-EM potentially more suitable for structural determination .

How does the CrcB protein contribute to F. tularensis pathogenicity and host immune evasion?

While the search results don't directly address CrcB's role in pathogenicity, we can infer potential functions based on the available genomic and methylation data on F. tularensis.

F. tularensis is a highly virulent bacterial pathogen that uses sophisticated mechanisms to evade host immune responses. The methylation patterns observed in F. tularensis subsp. holarctica appear to play a role in this immune evasion, as unmethylated CpG motifs trigger B-cell activation while methylated DNA does not . This suggests that methylation serves as part of the pathogen's stealth mechanism in macrophages .

As a membrane protein, CrcB likely contributes to the bacterium's interaction with its environment, potentially including the host milieu during infection. If CrcB functions as an ion channel (particularly for fluoride ions as seen in other bacterial homologs), it may play several potential roles in pathogenicity:

• Maintenance of ion homeostasis: Protecting the bacterium from toxic ion concentrations in the phagolysosome

• Membrane integrity: Contributing to the stability of the bacterial membrane during infection

• Stress response: Potentially involved in responding to oxidative or other stresses in the host environment

The gene encoding for CrcB (FTT_0260) may be regulated as part of the pathogen's adaptation to the host environment . The extensive methylation observed in the F. tularensis genome (including 586 methylation sites in the Cas9-like region) suggests that genes like crcB could be under complex regulation during infection .

What bioinformatic approaches are most effective for comparative analysis of CrcB across Francisella species?

Based on the comprehensive genomic analysis described in the search results, several bioinformatic approaches have proven effective for comparative analysis of Francisella proteins and could be applied specifically to CrcB analysis:

Recommended bioinformatic pipeline for CrcB analysis:

• Genome assembly and quality control:

  • SPAdes assembler in Bayes Hammer mode without preprocessing provided robust results across sequencing platforms

  • Hybrid assembly approach using both long reads (for initial assembly) and short reads (for correction) yields high-quality genomes

  • Excluding contigs smaller than 500 bp or with coverage lower than 3 improves quality

• Annotation and functional prediction:

  • PROKKA annotation identified 2114 coding DNA sequences (CDS) in F. tularensis subsp. holarctica, providing a baseline for identifying CrcB homologs

  • RAST and AUGUSTUS produce comparable results (2141 CDS)

  • For transmembrane protein prediction, tools like TMHMM and Phobius would be particularly relevant for CrcB analysis

• Phylogenetic analysis:

  • PhyloPhlAn provides accurate taxonomic identification and evolutionary relationships, achieving high precision from phyla to species level

  • This tool was able to define distinct genotypes for F. tularensis subsp. holarctica for representatives of major subclades (B.4, B.6, and B.12)

  • For protein-specific analysis like CrcB, MOLE-BLAST combined with PhyloPhlAn would provide high-resolution protein sequence analysis

• Methylation analysis:

  • Single-molecule real-time (SMRT) sequencing reveals methylation patterns that may affect gene expression

  • Analysis of methylation sites in promoter regions of crcB across species could reveal regulatory differences

This bioinformatic pipeline would allow researchers to identify and compare CrcB homologs across Francisella species, assess evolutionary relationships, predict structural features, and potentially identify regulatory patterns that influence expression.

How can recombinant CrcB protein be used in vaccine development against tularemia?

Recombinant CrcB protein could potentially be utilized in vaccine development strategies against tularemia through several approaches:

• Subunit vaccine component: As a membrane protein, CrcB could serve as an antigenic target in subunit vaccine formulations. The use of recombinant membrane proteins as vaccine antigens has proven effective for other bacterial pathogens.

• Diagnostic marker: Recombinant CrcB could be employed in ELISA-based diagnostic tests for tularemia, similar to the ELISA Recombinant Francisella tularensis subsp. tularensis Protein CrcB homolog product described in the search results .

• Immunological research: Recombinant CrcB provides a tool for studying host immune responses against specific F. tularensis antigens.

For vaccine development applications, researchers should evaluate:

• Immunogenicity of different CrcB epitopes

• Potential for cross-protection against different F. tularensis subspecies

• Appropriate delivery systems that maximize antigen presentation

• Combination with other F. tularensis antigens for broader protection

What experimental protocols are recommended for studying CrcB protein interactions with host cell receptors?

For investigating interactions between recombinant F. tularensis CrcB protein and host cell receptors, researchers should consider the following experimental protocols:

Protocol recommendations:

• Protein-protein interaction screening:

  • Co-immunoprecipitation (Co-IP) using tagged recombinant CrcB and host cell lysates

  • Yeast two-hybrid screening against host receptor libraries

  • Proximity labeling approaches (BioID or APEX) to identify proteins proximal to CrcB in host-pathogen interface

• Binding affinity and kinetics measurements:

  • Surface Plasmon Resonance (SPR) for real-time interaction analysis

  • Microscale Thermophoresis (MST) for measuring interactions in solution

  • Bio-Layer Interferometry (BLI) for label-free detection of biomolecular interactions

• Functional validation of interactions:

  • CRISPR-Cas9 knockout of identified host receptors followed by infection assays

  • Competitive inhibition assays using peptides derived from CrcB sequence

  • Site-directed mutagenesis of CrcB to identify critical residues for host interactions

• Visualization of interactions:

  • Immunofluorescence microscopy to detect co-localization

  • FRET (Förster Resonance Energy Transfer) for detecting molecular proximity

  • Super-resolution microscopy for detailed spatial analysis of interactions

When designing these experiments, researchers should be aware that the methylation status of F. tularensis DNA significantly affects host immune responses . Similarly, post-translational modifications of the CrcB protein may influence its interactions with host receptors. Therefore, recombinant protein production systems should be selected to maximize authentic folding and modification where possible.

How do environmental conditions affect the expression and function of CrcB in F. tularensis during infection?

The expression and function of CrcB in F. tularensis likely respond to changing environmental conditions during the infection cycle. While specific data on CrcB regulation is limited in the search results, we can extrapolate from the genomic and methylation analysis of F. tularensis:

Environmental factors potentially affecting CrcB expression:

• pH changes: As F. tularensis transitions from environmental reservoirs to mammalian hosts (e.g., macrophages), pH shifts may trigger expression changes in membrane proteins like CrcB.

• Ion concentrations: If CrcB functions as an ion channel (particularly for fluoride ions), its expression may be regulated in response to changing ionic conditions in different host compartments.

• Temperature: The transition from environmental temperatures to mammalian body temperature (37°C with 5% CO₂, as used for cultivation in the research) would likely trigger expression changes in multiple genes, potentially including crcB.

• Oxidative stress: Within macrophages, F. tularensis encounters oxidative stress, which may induce protective responses involving membrane proteins like CrcB.

The extensive methylation observed in F. tularensis (>150,000 methylation sites) likely plays a key role in regulating gene expression in response to these environmental changes . The methylation status of the crcB gene region could shift during different infection stages, altering its expression pattern.

To study these environmental effects experimentally, researchers could employ:

• RNA-seq analysis under varying environmental conditions

• Promoter-reporter fusion constructs to monitor crcB expression

• Protein level quantification using targeted proteomics

• Functional assays under different pH, temperature, and ion concentration conditions

What are the most promising approaches for targeting CrcB in antimicrobial drug development?

The CrcB protein represents a potential novel target for antimicrobial development against F. tularensis, particularly given its probable role as a membrane protein involved in essential cellular functions. Based on the available information, several approaches for targeting CrcB show promise:

• Small molecule inhibitors: Designing compounds that specifically block the ion channel function of CrcB could disrupt bacterial ion homeostasis. This approach would require:

  • High-resolution structural data of CrcB (currently not available)

  • Functional assays to screen compound libraries

  • Optimization of lead compounds for specificity and pharmacokinetic properties

• Peptide inhibitors: Developing peptides that mimic natural binding partners of CrcB could interfere with its function. The amino acid sequence provided in the search results (MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVIL GFYIVMGVYK) provides a starting point for identifying potential binding regions.

• Immunotherapeutic approaches: Using recombinant CrcB or its epitopes to develop antibodies that target the protein in vivo.

• CRISPR-Cas targeting: The search results mention that F. tularensis contains Cas9-like regions , suggesting potential for exploiting CRISPR-Cas systems for targeted antimicrobial approaches.

How can high-throughput screening methodologies be optimized for studying CrcB function?

Optimizing high-throughput screening (HTS) methodologies for studying CrcB function requires addressing the challenges associated with membrane protein analysis while maximizing throughput and data quality:

Recommended HTS optimization strategies:

• Expression system optimization:

  • Develop stable cell lines expressing CrcB fusion constructs with reporter tags

  • Optimize induction conditions for consistent protein expression levels

  • Scale production in multi-well format suitable for automated handling

• Functional assay development:

  • Ion flux assays using fluorescent indicators sensitive to CrcB's putative substrates

  • Growth-based assays in CrcB-deficient strains complemented with variant constructs

  • Binding assays using labeled ligands or potential inhibitors

• Structural stability screening:

  • Thermal shift assays adapted to membrane proteins in detergent micelles

  • Limited proteolysis coupled with mass spectrometry for conformational analysis

  • Surface display technologies for stability engineering

• Data analysis pipeline:

  • Implement machine learning approaches for hit identification and validation

  • Develop structure-activity relationship models based on screening results

  • Integrate multiple assay readouts for comprehensive functional profiling

The high-quality genome sequence and bioinformatic analysis pipeline described for F. tularensis subsp. holarctica provides a foundation for designing genetic constructs and interpreting screening results in a genomic context . The SPAdes assembler in Bayes Hammer mode without preprocessing, which yielded robust results in the genomic analysis, could be adapted for analyzing next-generation sequencing data from functional genomics screens targeting CrcB .

What are the implications of DNA methylation patterns for CrcB gene regulation across Francisella species?

The extensive DNA methylation patterns observed in F. tularensis have significant implications for gene regulation, including potentially for the crcB gene. The search results indicate that more than 150,000 methylation sites were detected in F. tularensis subsp. holarctica, with 12-40% of these sites being methylated . This methylation involves several types of modifications including N6-methyl-adenosine (m6A), N4-methyl-cytosine (m4C), and N5-methyl-cytosine (m5C) .

Implications for crcB gene regulation:

• Differential expression during infection: The methylation status of F. tularensis DNA has been shown to affect host immune responses, with unmethylated CpG motifs triggering B-cell activation while methylated DNA does not . This suggests that methylation patterns may change during infection stages, potentially affecting genes like crcB involved in bacterial survival.

• Subspecies-specific regulation: The comprehensive genome analysis shows that F. tularensis subsp. holarctica has distinctive features compared to other subspecies . The methylation patterns could contribute to subspecies-specific regulation of genes including crcB.

• Evolutionary conservation: The remarkably low genetic evolution observed in F. tularensis subsp. holarctica suggests that critical regulatory mechanisms, potentially including methylation patterns, are highly conserved. This may indicate that crcB regulation through methylation is similarly conserved.

• Impact on transcription factor binding: Methylation can directly affect the binding of transcription factors to promoter regions. The strand-specific genome-wide methylation analyzed in 10 kb windows and strand-specific methylation per gene would influence which regulatory proteins can access the crcB promoter.

For studying these methylation effects experimentally, the single-molecule real-time (SMRT) sequencing approach used for F. tularensis subsp. holarctica would be particularly valuable, as it reveals methylation throughout the genome and could be applied to compare methylation patterns of the crcB gene region across different Francisella species and under various environmental conditions.