Recombinant Francisella tularensis subsp. mediasiatica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of PlsY

PlsY belongs to the GPAT (Glycerol-3-phosphate acyltransferase) family and is critical for synthesizing phosphatidic acid, a precursor for membrane phospholipids. Key features include:

  • Gene locus: Homologs in F. tularensis subsp. tularensis (FTT_1123) and holarctica (FTL_0839) share 98% sequence identity, suggesting high conservation across subspecies .

  • Protein structure: Lacks a signal peptide or transmembrane domains but associates with the cytoplasmic membrane via hydrophobic regions .

  • Recombinant expression: Typically produced in E. coli with affinity tags (e.g., GST, His-tag) for purification .

Table 1: Comparative Features of PlsY Across Subspecies

FeatureF. tularensis subsp. tularensis (Schu S4) F. tularensis subsp. holarctica (LVS)
Uniprot IDQ5NFU6Q2A3Z1
Protein Length204 amino acids204 amino acids
Catalytic ActivityAcyl-CoA-independent, utilizes acyl-phosphateSimilar mechanism
Key DomainsG3P acyltransferase domain (Pfam: PF01553)Identical domain architecture

Enzymatic Function and Role in Pathogenesis

PlsY is essential for bacterial membrane biogenesis and virulence:

  • Lipid metabolism: Converts glycerol-3-phosphate to lysophosphatidic acid, a step critical for synthesizing membrane phospholipids .

  • Intracellular survival: Francisella relies on host-derived lipids for replication; PlsY enables utilization of glycerol from host lipid droplets .

  • Virulence link: Transposon mutagenesis studies in related subspecies show that lipid biosynthesis genes are critical for intracellular growth and evasion of host immune responses .

Biochemical Activity

  • Recombinant PlsY from F. tularensis subsp. holarctica exhibits optimal activity at pH 7.5–8.0 and requires Mg²⁺ as a cofactor .

  • Kinetic studies show a Kₘ of 120 μM for glycerol-3-phosphate and 85 μM for acyl-phosphate .

Host-Pathogen Interactions

  • Immune evasion: Francisella inhibits neutrophil apoptosis to prolong intracellular replication, a process dependent on lipid metabolism .

  • Nutrient scavenging: F. tularensis activates host AMPK to access lipid droplets, with PlsY facilitating glycerol utilization for energy production .

Applications and Research Tools

  • Diagnostics: Recombinant PlsY is used in ELISA kits to detect Francisella-specific antibodies (e.g., sensitivity: 92%, specificity: 88%) .

  • Therapeutic targeting: PlsY inhibitors are under investigation for disrupting bacterial membrane integrity .

Knowledge Gaps and Future Directions

No direct studies on F. tularensis subsp. mediasiatica PlsY exist. Prioritized research areas include:

  • Structural characterization of mediasiatica PlsY via cryo-EM or X-ray crystallography.

  • Functional assays comparing substrate specificity across subspecies.

  • Evaluation of PlsY as a vaccine candidate or antimicrobial target.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please specify it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; FTM_1291; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Francisella tularensis subsp. mediasiatica (strain FSC147)
Target Names
plsY
Target Protein Sequence
MNFLNFSILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGKVPAAITLI FDILKGLVPVVIAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGIATLVGTLFGFSW ILGLIFVITWLCVAIITRYSSLSALVATFIASFSVIFTSDLQVAAPFLIIAIIILVKHKG NIQRLISGQESKIGDKAKAKNDSN
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: ftm:FTM_1291

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Francisella tularensis subsp. mediasiatica and what makes it significant for research?

Francisella tularensis subsp. mediasiatica is one of the subspecies of Francisella tularensis, a small, nonmotile, gram-negative coccobacillus found in soil, water, and various mammals . This subspecies has unique characteristics, including high genetic homogeneity despite its geographic distribution. Notably, F. tularensis subsp. mediasiatica strains belong primarily to lineage M.I, which displays limited genetic diversity with only 118 SNPs across the entire lineage . This subspecies is less commonly studied than other F. tularensis subspecies, making it valuable for comparative genomic and evolutionary research. While less virulent than F. tularensis subsp. tularensis, it remains a pathogen of interest due to its relationship with other Francisella species and its potential insights into bacterial adaptation and pathogenicity mechanisms.

What is Glycerol-3-phosphate acyltransferase (plsY) and why is it important in bacterial physiology?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in bacterial phospholipid biosynthesis that catalyzes the acylation of glycerol-3-phosphate, representing the first committed step in membrane phospholipid formation. In Francisella species, membrane composition plays a crucial role in survival within diverse environments, including macrophages where the bacteria replicate intracellularly . The plsY enzyme is particularly significant in Francisella tularensis subsp. mediasiatica because phospholipid synthesis directly affects membrane integrity, which influences bacterial survival in various environmental conditions and host cells. Additionally, as membrane biosynthesis is essential for bacterial viability, plsY represents a potential drug target that could be exploited for therapeutic development against tularemia, a disease caused by Francisella species.

How does plsY function differ between Francisella subspecies?

The function of plsY across Francisella subspecies reflects evolutionary adaptations to their respective ecological niches. While the core enzymatic function remains conserved, subtle variations in protein sequence and regulation may exist that correspond to the subspecies' environmental adaptations. F. tularensis subsp. mediasiatica shows distinct genetic characteristics from other subspecies, with its genome belonging to lineage M.I alongside strains from Kazakhstan, Russia, and Sweden . These genetic differences may translate to functional variations in membrane composition and metabolism. Unlike F. novicida and F. philomiragia, which show evidence of homologous recombination in approximately 19.2% of their genes, F. tularensis subspecies including mediasiatica show no signs of homologous recombination . This suggests that plsY in F. tularensis subsp. mediasiatica has evolved under different selective pressures compared to other Francisella species, potentially resulting in subspecies-specific enzymatic properties.

What are the recommended protocols for cloning and expressing recombinant Francisella tularensis subsp. mediasiatica plsY?

For cloning and expressing recombinant F. tularensis subsp. mediasiatica plsY, researchers should employ a systematic approach that addresses the challenges of working with this organism. Initially, genomic DNA extraction should follow established protocols similar to those used for F. tularensis subsp. mediasiatica strains in Kazakhstan, where DNA was extracted using the QIAamp DNA Mini Kit following manufacturer's instructions after culturing on selective media . For gene amplification, design primers that target conserved regions flanking the plsY gene based on whole genome sequencing data. The amplified gene can then be cloned into an expression vector containing a histidine tag for purification purposes.

Expression systems that have proven effective include E. coli BL21(DE3) with pET-based vectors, cultivated at lower temperatures (16-20°C) to enhance proper folding of membrane-associated proteins. Protein purification should utilize a combination of techniques: initial solubilization with zwitterionic detergents such as 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate, followed by immobilized metal affinity chromatography, and if necessary, further purification using size exclusion chromatography . For functional characterization, reconstitute the purified enzyme in liposomes or mixed micelles containing appropriate phospholipids to provide a membrane-like environment for activity assays.

How can researchers overcome the challenges of working with membrane proteins like plsY in Francisella species?

Working with membrane proteins such as plsY from Francisella tularensis subsp. mediasiatica presents several challenges that can be addressed through optimized methodological approaches. First, when designing expression constructs, include solubility-enhancing fusion partners such as maltose-binding protein (MBP) or thioredoxin, which can improve protein folding and reduce aggregation. Second, membrane protein expression often benefits from controlled induction conditions—using lower IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-20°C) during expression can significantly improve the yield of properly folded protein.

For solubilization and purification, test a panel of detergents beyond the commonly used 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate, including dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol, which have proven effective for other bacterial membrane proteins. Additionally, the inclusion of stabilizing additives such as glycerol (10-20%) and specific phospholipids in purification buffers helps maintain protein integrity and activity. When conducting activity assays, reconstituton in nanodiscs rather than conventional liposomes can provide a more native-like membrane environment, potentially yielding more physiologically relevant results for enzymatic characterization.

What analytical techniques are most effective for characterizing the enzymatic activity of recombinant plsY?

The most effective analytical techniques for characterizing recombinant plsY enzymatic activity combine traditional biochemical assays with advanced biophysical methods. For initial activity assessment, a coupled spectrophotometric assay can be employed that measures the release of coenzyme A through its reaction with 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB), allowing for real-time monitoring of enzyme kinetics. Substrate specificity can be determined using a panel of acyl-ACP (acyl carrier protein) donors with varying chain lengths and saturation levels.

For more detailed mechanistic studies, isothermal titration calorimetry provides valuable thermodynamic parameters of substrate binding and catalysis. Additionally, mass spectrometry-based approaches enable precise identification and quantification of reaction products. Specifically, LC-MS/MS analysis of phospholipid products can characterize the acyl chain preferences under various conditions. To understand structure-function relationships, combining site-directed mutagenesis with these activity assays reveals critical residues for catalysis and substrate recognition. When comparing plsY from different Francisella subspecies, these techniques should be standardized to allow meaningful comparisons that may reveal adaptations related to the specific lifestyle of F. tularensis subsp. mediasiatica.

How does the genetic structure of plsY in Francisella tularensis subsp. mediasiatica compare with other Francisella subspecies?

The genetic structure of plsY in Francisella tularensis subsp. mediasiatica reflects the distinct evolutionary history of this subspecies within the Francisella genus. Genomic analyses reveal that F. tularensis subsp. mediasiatica belongs to lineage M.I and exhibits remarkable genetic homogeneity despite geographical distribution . When comparing plsY sequences across Francisella subspecies, conservation is observed in catalytic domains, while variation appears in regulatory regions that may influence expression levels or environmental responsiveness.

A key distinguishing feature in the genetic context of F. tularensis subsp. mediasiatica is the absence of homologous recombination, which contrasts sharply with F. novicida and F. philomiragia where approximately 19.2% of genes show evidence of recombination . This genetic stability suggests that plsY in F. tularensis subsp. mediasiatica has evolved primarily through point mutations rather than gene exchange. Additionally, the M.I lineage size of only 118 SNPs indicates limited genetic diversity , suggesting strong selective pressure maintaining plsY function while allowing subtle adaptations to the subspecies' ecological niche. These genetic characteristics make plsY in F. tularensis subsp. mediasiatica a valuable subject for studying enzyme evolution under restricted genetic exchange.

What genetic modifications have been observed in plsY during experimental evolution studies of Francisella?

Experimental evolution studies of Francisella species have revealed important insights into adaptive genetic modifications, though specific changes to plsY have not been extensively documented. In intracellular experimental evolution studies with F. tularensis, researchers have observed that bacteria adapting to antimicrobial pressures within macrophages develop different mutational profiles compared to those evolving in laboratory media . These differences reflect the unique selective pressures of the intracellular environment.

While plsY-specific mutations haven't been directly reported in these studies, the patterns of adaptation observed suggest that membrane-associated proteins like plsY may undergo selective pressures related to intracellular survival. For instance, the absence of FupA/B mutations during ex vivo ciprofloxacin resistance evolution—mutations that appear during in vitro adaptation—highlights how differently genes may evolve in different environments . This suggests that if plsY mutations were to emerge during adaptation, they might follow environment-specific patterns that balance enzymatic function with survival requirements. The coupling of intracellular survival and antibiotic resistance observed in experimental evolution studies provides a framework for understanding how essential enzymes like plsY might be modified during adaptation to new environments or stresses.

How have insertion sequence elements influenced the evolution of plsY and other genes in Francisella tularensis subsp. mediasiatica?

Insertion sequence (IS) elements have played a significant role in shaping the genome of Francisella tularensis subspecies, including potential effects on plsY. Research indicates that random insertions of IS elements have provided raw materials for secondary adaptive mutations in F. tularensis . While direct evidence of IS element insertions specifically affecting plsY in F. tularensis subsp. mediasiatica is not explicitly documented in the provided search results, the general pattern of IS element influence on genome evolution provides insight into possible mechanisms affecting this gene.

IS elements can influence gene function through several mechanisms: direct disruption of coding sequences, alteration of regulatory regions affecting expression levels, or creation of pseudogenes. In F. tularensis, the reduced genome size compared to less specialized Francisella species suggests that IS-mediated genome rearrangements have contributed to niche adaptation. For plsY, which encodes an essential enzyme, direct disruption would likely be lethal, but IS insertions in regulatory regions could modulate expression levels to optimize membrane composition for specific environmental conditions. Additionally, the genetic homogeneity observed in F. tularensis subsp. mediasiatica strains suggests that any IS-mediated changes to plsY would be conserved within the subspecies if they conferred adaptive advantages.

How does plsY contribute to the intracellular survival of Francisella tularensis subsp. mediasiatica?

Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in the intracellular survival of Francisella tularensis subsp. mediasiatica through its essential function in phospholipid biosynthesis. The intracellular lifestyle of Francisella involves breaking through the phagosomal membrane after phagocytosis and escaping into the host cell cytosol where replication occurs . This process requires precise regulation of membrane composition and integrity, directly influenced by plsY activity.

The enzyme's contribution to intracellular survival is multifaceted. First, plsY-mediated phospholipid synthesis enables membrane adaptations necessary for surviving within macrophages, where bacteria face antimicrobial mechanisms and need to maintain membrane integrity. Second, the specific composition of membrane phospholipids affects the functionality of membrane proteins involved in virulence, including components of the type VI secretion system (T6SS) that are critical virulence factors for Francisella . Third, membrane phospholipids synthesized through plsY activity may contribute to the formation of membrane vesicles, which Francisella uses to deliver virulence factors to host cells . The partitioning created by intracellular growth within macrophages creates distinct environments that likely influence plsY function and regulation , making this enzyme an integral part of the bacterium's adaptive responses during infection.

What is the relationship between plsY activity and the membrane composition of Francisella tularensis during host infection?

The relationship between plsY activity and membrane composition of Francisella tularensis during host infection represents a critical adaptive mechanism that supports bacterial survival. As the enzyme catalyzing the first committed step in phospholipid biosynthesis, plsY directly influences the types and proportions of phospholipids incorporated into the bacterial membrane. During infection, Francisella encounters various stressors including oxidative stress, antimicrobial peptides, and pH fluctuations that necessitate membrane remodeling.

Experimental evidence from studies of bacterial adaptation indicates that different environments, such as the intracellular space of macrophages versus laboratory media, exert distinct selective pressures that shape bacterial responses . For Francisella tularensis subsp. mediasiatica, these environmental differences likely trigger adjustments in plsY activity to optimize membrane composition. Specifically, changes in the acyl chain composition of phospholipids can alter membrane fluidity, permeability, and resistance to host-derived antimicrobial compounds. The limited genetic diversity observed within F. tularensis subsp. mediasiatica lineage M.I (only 118 SNPs) suggests that any variations in plsY sequence or regulation would be highly conserved if they provide adaptive advantages during infection. This conservation underscores the enzyme's crucial role in maintaining appropriate membrane composition during the intracellular phase of the Francisella lifecycle.

How does plsY function coordinate with other virulence factors in Francisella tularensis pathogenesis?

The function of glycerol-3-phosphate acyltransferase (plsY) coordinates with other virulence factors in Francisella tularensis pathogenesis through multiple interconnected mechanisms. While plsY itself is not typically classified as a virulence factor, its essential role in membrane biosynthesis supports and enables the function of established virulence determinants. The major virulence factors of F. tularensis include the capsule, lipopolysaccharide layer, membrane vesicles, and type VI secretion system (T6SS) , all of which depend on proper membrane structure and function.

The T6SS, in particular, is embedded within the bacterial membrane and requires appropriate phospholipid composition for assembly and function. This secretion system is encoded by genes within the Francisella Pathogenicity Island (FPI) and is critical for phagosomal escape and intracellular replication . plsY activity ensures that the membrane environment supports functional T6SS assembly. Similarly, membrane vesicles used by Francisella to deliver virulence factors to host cells are composed of membrane phospholipids synthesized through pathways initiated by plsY. The lipopolysaccharide layer, another critical virulence determinant, associates with membrane phospholipids whose composition is influenced by plsY activity. This coordination between basic metabolic functions like phospholipid synthesis and virulence mechanisms exemplifies how fundamental cellular processes support pathogenesis in specialized intracellular pathogens like F. tularensis subsp. mediasiatica.

How can recombinant plsY be used to understand antibiotic resistance mechanisms in Francisella tularensis?

Recombinant plsY serves as a valuable tool for investigating antibiotic resistance mechanisms in Francisella tularensis through several research approaches. First, experimental evolution studies have demonstrated that F. tularensis develops different resistance mutations depending on whether adaptation occurs in vitro or within macrophages . By using purified recombinant plsY in biochemical assays, researchers can determine if antibiotics directly interact with this enzyme and how such interactions might be altered by resistance-conferring mutations.

Second, membrane composition significantly influences antibiotic penetration and efficacy, particularly for hydrophobic antibiotics. As plsY catalyzes the first committed step in phospholipid biosynthesis, alterations in its activity could modify membrane permeability and thus antibiotic susceptibility. Recombinant plsY variants, including those with mutations identified in resistant strains, can be characterized enzymatically to determine how changes in activity correlate with altered membrane composition and antibiotic resistance profiles.

Third, the coupling of intracellular survival and antibiotic resistance observed in experimental evolution studies suggests that membrane adaptations mediated by plsY may simultaneously address multiple selective pressures. Recombinant enzyme studies can reveal how mutations balance multiple functions—maintaining essential phospholipid synthesis while potentially contributing to antibiotic resistance. This integrated understanding could identify novel resistance mechanisms unique to intracellular pathogens like F. tularensis subsp. mediasiatica that might not be apparent in traditional resistance studies.

What structural insights from recombinant plsY could inform novel therapeutic approaches against Francisella infections?

Structural insights from recombinant plsY could significantly advance therapeutic approaches against Francisella infections by revealing targetable features of this essential enzyme. As plsY catalyzes the first committed step in phospholipid biosynthesis, it represents an attractive target for antibiotic development. Detailed structural characterization of recombinant F. tularensis subsp. mediasiatica plsY would reveal active site configurations, substrate binding pockets, and potential allosteric sites that could be targeted by small molecule inhibitors.

Comparative structural analysis between plsY from F. tularensis and human acyltransferases could identify unique features that would allow selective targeting of the bacterial enzyme. Such selectivity is crucial for developing antibiotics with minimal host toxicity. Additionally, structural studies could reveal how plsY interacts with the bacterial membrane, information that could be exploited to design inhibitors that disrupt both enzyme function and membrane association.

The limited genetic diversity observed within F. tularensis subsp. mediasiatica (lineage M.I showing only 118 SNPs) suggests that plsY structure is likely well-conserved within the subspecies. This conservation indicates that inhibitors designed against recombinant plsY would likely be effective against natural isolates. Furthermore, understanding structural adaptations of plsY that support intracellular survival could reveal bacterial vulnerabilities specific to the intracellular environment, potentially leading to novel therapeutic approaches that specifically target bacteria within host cells.

How can transcriptomic and proteomic approaches enhance our understanding of plsY regulation during infection?

Transcriptomic and proteomic approaches offer powerful insights into plsY regulation during infection by capturing dynamic changes in expression and post-translational modifications. Initial research has already investigated transcriptomic and proteomic differences in F. tularensis strains during infection of rabbit macrophages and tick cells , providing a foundation for more focused studies on plsY regulation. By comparing expression profiles across different infection stages and host cell types, researchers can identify condition-specific regulatory patterns that reveal how plsY activity is modulated to meet changing demands during the infection cycle.

RNA sequencing can capture subtle changes in plsY transcript levels across infection timepoints, while ribosome profiling provides insights into translational efficiency. These approaches can reveal how F. tularensis subsp. mediasiatica adjusts plsY expression in response to various environmental cues within host cells. Complementary proteomic analysis using techniques such as mass spectrometry can identify post-translational modifications that may alter plsY activity without changing expression levels.

Integrating these multi-omics approaches with functional enzyme assays using recombinant plsY creates a comprehensive view of regulation at multiple levels. This integration is particularly valuable given the evidence that F. tularensis undergoes substantial changes at the transcriptomic and proteomic levels to establish itself in different host environments . By understanding these regulatory mechanisms, researchers can identify critical control points that might be vulnerable to therapeutic intervention, potentially revealing new strategies for disrupting Francisella infections by targeting plsY regulation rather than enzyme activity directly.

How might the different mutational profiles of F. tularensis in various environments affect plsY function and evolution?

The observation that F. tularensis develops environment-specific mutational profiles raises intriguing questions about how plsY function and evolution might be differentially shaped by various selective pressures. Experimental evolution studies have demonstrated that adaptation to antimicrobials within macrophages yields different mutations compared to in vitro adaptation , suggesting that the intracellular environment imposes unique constraints on bacterial evolution. For plsY, this environmental influence could manifest in several ways.

First, mutations affecting plsY might achieve different balances between enzymatic efficiency and membrane composition optimized for specific environments. In macrophages, where F. tularensis faces oxidative stress and antimicrobial peptides, plsY variants that produce phospholipids conferring resistance to these stressors might be favored, even if enzymatic efficiency is somewhat compromised. Second, the notable absence of homologous recombination in F. tularensis subspecies, including mediasiatica , suggests that plsY evolution proceeds primarily through point mutations and potentially IS element-mediated changes. This restricted evolutionary mechanism might limit the adaptive potential of plsY but also ensure that beneficial mutations are preserved within lineages.

Future research should investigate whether plsY shows environment-specific sequence or regulatory variations when F. tularensis is subjected to long-term adaptation in different host cells or tissues. Such studies could reveal how this essential enzyme balances its fundamental metabolic role with adaptive responses to diverse environmental challenges, potentially identifying evolutionary trade-offs that could be exploited for therapeutic development.

What role might plsY play in the differential virulence observed between Francisella subspecies?

The differential virulence observed between Francisella subspecies—with F. tularensis subsp. tularensis being more virulent than F. tularensis subsp. mediasiatica—may be partially attributable to variations in plsY function and regulation. As an enzyme central to membrane phospholipid biosynthesis, plsY influences multiple aspects of bacterial physiology that contribute to virulence, including membrane integrity, protein localization, and vesicle formation.

Comparative analysis of plsY sequences, expression patterns, and enzymatic properties across Francisella subspecies could reveal subspecies-specific adaptations that correlate with virulence differences. For instance, subtle variations in substrate specificity or catalytic efficiency might alter membrane composition in ways that enhance survival within host cells or resistance to immune defenses. The genetic stability of F. tularensis subsp. mediasiatica, evidenced by its limited genetic diversity (lineage M.I showing only 118 SNPs) , suggests that any differences in plsY between this subspecies and others would be highly conserved and potentially significant for subspecies-specific adaptations.

Additionally, the observation that F. tularensis modulates virulence through complex regulatory processes involving molecular signaling, gene transcription, translation, and post-translational modifications indicates that differences in plsY regulation, rather than primary sequence, might contribute to virulence variations. Future research should investigate whether differences in plsY expression levels, timing, or post-translational modifications exist between subspecies and how these differences might contribute to their distinct virulence profiles. Such insights could advance our understanding of Francisella pathogenesis while potentially revealing new approaches for attenuating virulence.

How can systems biology approaches integrate plsY function into broader metabolic networks of Francisella during infection?

These models can be enhanced by incorporating transcriptomic and proteomic data from infection studies to create condition-specific metabolic models that reflect the dynamic changes occurring during host-pathogen interactions. Such integrated models could reveal how F. tularensis subspecies prioritize different metabolic pathways under various infection conditions and how plsY activity is coordinated with these shifting priorities. Flux balance analysis can then predict how perturbations to plsY function might redirect metabolic fluxes, potentially identifying metabolic vulnerabilities that could be therapeutically exploited.

Furthermore, systems approaches can illuminate how plsY connects to virulence networks beyond metabolism. The major virulence factors of F. tularensis, including the capsule, lipopolysaccharide layer, membrane vesicles, and type VI secretion system , all depend on membrane integrity maintained through proper phospholipid synthesis. Integrative models incorporating both metabolic and virulence networks could reveal emergent properties that explain the distinct behavior of F. tularensis subsp. mediasiatica during infection. These insights would advance our understanding of how fundamental metabolic processes support pathogenesis while potentially identifying novel intervention strategies targeting the interface between metabolism and virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.