Recombinant Francisella tularensis subsp. mediasiatica Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Francisella tularensis subsp. mediasiatica Membrane Protein Insertase YidC

Recombinant Francisella tularensis subsp. mediasiatica membrane protein insertase YidC (yidC) is a significant protein involved in the insertion of membrane proteins in various bacterial species, particularly within the context of pathogenic organisms such as Francisella tularensis. This protein plays a crucial role in the proper folding and integration of membrane proteins, which are vital for the bacterium's survival and virulence.

Key Features of YidC:

  • Gene Name: yidC

  • Species: Francisella tularensis subsp. mediasiatica

  • Protein Length: Typically ranges from 551 amino acids.

  • UniProt ID: B0TW73

  • Purity: Greater than 90% as determined by SDS-PAGE.

  • Storage Conditions: Recommended storage at -20°C to -80°C; avoid repeated freeze-thaw cycles.

Research Findings

Recent studies have provided insights into the proteomic profile of Francisella tularensis, highlighting differences between subspecies that may influence virulence. The yidC gene is particularly interesting due to its differential expression in virulent versus avirulent strains.

Table 1: Comparative Proteomic Analysis

FeatureF. tularensis subsp. tularensisF. tularensis subsp. mediasiatica
Unique Proteins Identified27Fewer than 10
Virulence Factor PresenceYesLimited
Membrane Protein InsertaseYidCPresent

Applications in Research and Medicine

The recombinant form of YidC has been utilized in various applications, including:

  • Vaccine Development: Understanding how YidC interacts with immune cells can aid in designing vaccines against tularemia.

  • Pathogenicity Studies: By studying YidC, researchers can gain insights into the mechanisms that allow F. tularensis to evade host immune responses.

References

  1. Creative BioMart (2025). Recombinant Full Length Francisella philomiragia subsp. philomiragia Membrane Protein Insertase YidC.

  2. CusaBio (2025). Recombinant Francisella tularensis subsp. tularensis Membrane Protein Insertase YidC.

  3. PMC (2006). Characterization of Francisella tularensis Outer Membrane Proteins.

  4. PMC (2011). The Francisella Tularensis Proteome and its Recognition by Immune Cells.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
yidC; FTM_1616; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Francisella tularensis subsp. mediasiatica (strain FSC147)
Target Names
yidC
Target Protein Sequence
MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNSHYDNADSSTNTDVTT TDAKSSLAKETNFSKYDNAKSITINTGVFKDVKVSLLDGAIISASLKDYSISLDDKTPMS LLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKIENGKQILTLTGSADGLQITRTYTFDD TKYNISVSQNIKNTTSAPVNVIVDDSFARGFDPAGDSFSLLNAHSYTFTGVAYSTAKDSF RKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQSTNAKIYYKNLNGDVFEAGA FTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNHIHS LVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETYKDDRQALGKKMM ELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPV LMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFASFPSGLVLYWLTNNLISISQQWI ITRHYQATHKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cellular membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: ftm:FTM_1616

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Francisella tularensis subsp. mediasiatica and how does it differ from other Francisella subspecies?

Francisella tularensis subsp. mediasiatica is one of four recognized subspecies of F. tularensis, a Gram-negative bacterial pathogen that causes tularemia. The four subspecies (tularensis, holarctica, mediasiatica, and novicida) differ in their virulence and geographic distribution. Subspecies mediasiatica remains poorly studied primarily because it is found only in sparsely populated regions of Central Asia and Russia . Comparative virulence studies have demonstrated that F. tularensis subsp. mediasiatica occupies an intermediate position in virulence between subspecies tularensis (most virulent) and holarctica . Specifically, it has been shown to be comparable in pathogenicity to subspecies tularensis in mice models and to subspecies holarctica in guinea pig models .

Despite high genetic similarity (>97% average nucleotide identity) among Francisella subspecies, evolutionary analyses have revealed distinct population lineages. F. tularensis (including subsp. mediasiatica) is characterized by a clonal structure with weak purifying selection, whereas F. novicida exhibits more frequent recombination and strong purifying selection .

What is YidC and what functions does it serve in bacterial membranes?

YidC is a prominent member of the Oxa1 superfamily and plays essential roles in bacterial inner membrane biogenesis. It significantly influences membrane protein composition and lipid organization . YidC functions through several mechanisms:

  • As a partner to the Sec translocon, aiding in the proper folding of multi-pass membrane proteins

  • As an independent insertase, facilitating the insertion of smaller membrane proteins

  • As a lipid scramblase, contributing to membrane bilayer organization

YidC's diverse functions make it crucial for bacterial membrane integrity and function. In bacterial systems, YidC has been shown to enhance the production and membrane insertion of various substrates, including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and various small membrane proteins like SecG .

How do vaccination strategies affect protection against F. tularensis subsp. mediasiatica infection?

Vaccination studies have revealed important insights about protection against F. tularensis subsp. mediasiatica. Current live vaccines do not fully protect mice from subsp. mediasiatica but can completely protect guinea pigs for at least six months . This differential protection between animal models highlights important considerations for vaccine development.

When laboratory animals were vaccinated and then challenged with virulent strains (subsp. mediasiatica 678, subsp. holarctica 503, and subsp. tularensis SCHU) within 60 to 180 days after vaccination, the results showed that vaccine efficacy varied by both host species and the challenging Francisella subspecies . These findings suggest that vaccine development for tularemia must consider the specific subspecies prevalent in different geographic regions, including the less-studied mediasiatica subspecies.

How does the molecular evolution of F. tularensis subsp. mediasiatica influence its virulence and pathogenicity mechanisms?

The molecular evolution of F. tularensis subsp. mediasiatica shows distinctive patterns that likely influence its virulence profile. Comparative genomic studies revealed that F. tularensis subspecies, including mediasiatica, have converged along independent routes toward a common gene set through independent losses of gene functions . Random insertions of insertion sequence elements appear to have provided raw materials for secondary adaptive mutations in F. tularensis, such as duplication of the Francisella Pathogenicity Island and multiplication of a putative glycosyl transferase gene .

Unlike F. novicida and F. philomiragia, which show signs of homologous recombination in approximately 19.2% of their genes, F. tularensis genomes (including subsp. mediasiatica) display no evidence of such recombination . This lack of recombination suggests a more specialized, host-adapted lifestyle for F. tularensis subsp. mediasiatica compared to the less virulent species, which appear to maintain more diverse gene pools through recombination.

The distinct evolutionary trajectory of F. tularensis subsp. mediasiatica has likely shaped its intermediate virulence profile, which combines characteristics from both the highly virulent subsp. tularensis and the moderately virulent subsp. holarctica .

What is the relationship between YidC and YibN, and how does this interaction affect membrane protein biogenesis in bacteria?

The relationship between YidC and YibN represents a crucial aspect of bacterial membrane biology. YibN has been identified as a significant physical and functional interactor of YidC through multiple experimental approaches . Proximity-dependent biotin labeling (BioID), affinity purification-mass spectrometry assays on native membranes, and on-gel binding assays with purified proteins have all confirmed this association .

The interaction between YidC and YibN has several functional consequences:

  • YibN enhances the production and membrane insertion of YidC substrates, including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and small membrane proteins like SecG

  • YibN overexpression stimulates membrane lipid production, resulting in approximately 4-fold more membrane lipids than control strains

  • YibN promotes inner membrane proliferation, leading to membrane circumvolutions and multilayered structures

The YibN transmembrane segment (residues 1-29) is essential for the formation of the YidC-YibN complex, as deletion of this segment prevents association with YidC .

How might Type IV pili contribute to the pathogenicity of F. tularensis subsp. mediasiatica compared to other subspecies?

Studies of F. novicida have shown contradictory findings regarding the pilA gene (encoding a major Tfp component): one study found that a pilA mutant was more virulent than the wildtype strain, while another found that pilA mutants were attenuated . These contradictions might be due to differences in experimental conditions or strain variations.

Given that F. tularensis subsp. mediasiatica occupies an intermediate position in virulence between subspecies tularensis and holarctica , understanding the contribution of Tfp to its pathogenicity could provide insights into the molecular basis of this intermediate virulence profile.

What are the optimal approaches for studying YidC-mediated membrane protein insertion in F. tularensis subsp. mediasiatica?

Studying YidC-mediated membrane protein insertion in F. tularensis subsp. mediasiatica requires multiple complementary approaches:

  • Proximity-dependent biotin labeling (BioID): This technique has been successfully used to identify YidC interactors by fusing a mutant biotin ligase (BirA*) to the C-terminus of YidC . After protein expression, the bacterial inner membrane is isolated, solubilized with detergent (typically 1% DDM), and biotinylated proteins are detected via Western blot and identified by LC-MS/MS.

  • Affinity pulldown assays: Using His-tagged YidC or YibN, researchers can identify interaction partners under native conditions. SILAC-labeling with lysine isotopologues allows quantitative comparison between experimental and control samples .

  • Native-gel electrophoresis: Purified proteins can be analyzed by blue-native PAGE to visualize protein complexes. This approach has been used to demonstrate that YidC and YibN form a distinctive band when incubated together .

  • Co-expression studies: YidC substrates (such as M13 procoat, Pf3 coat proteins, or F1-F0 subunit F0c) can be co-expressed with potential regulators or interactors to assess effects on membrane insertion efficiency .

  • Transmission electron microscopy: This technique can be used to visualize membrane morphology changes associated with YidC activity or modification, such as membrane proliferation induced by YibN overexpression .

For F. tularensis subsp. mediasiatica specifically, biosafety considerations must be paramount due to the pathogen's virulence and potential for aerosolization.

What experimental systems are most appropriate for studying the virulence of F. tularensis subsp. mediasiatica?

Appropriate experimental systems for studying F. tularensis subsp. mediasiatica virulence include:

  • Multiple animal models: Different animal models show varying susceptibility to F. tularensis subsp. mediasiatica. Mice appear to be more susceptible than guinea pigs to this subspecies, with mediasiatica showing virulence comparable to subsp. tularensis in mice but more similar to subsp. holarctica in guinea pigs . Thus, a comprehensive virulence assessment should include both models.

  • Vaccination-challenge models: Vaccinated animals can be challenged with virulent strains 60-180 days post-vaccination to assess vaccine efficacy and comparative virulence . This approach has shown that live vaccines completely protect guinea pigs but not mice from subsp. mediasiatica.

  • Biosafety considerations: Since F. tularensis subsp. mediasiatica is virulent, experiments must be conducted under appropriate biosafety conditions, typically BSL-3.

  • Genetic manipulation: Creating defined mutants in virulence-associated genes (such as those in the Francisella Pathogenicity Island) can help elucidate the specific contributions of these genes to mediasiatica's intermediate virulence profile.

  • Cell culture models: Macrophage infection models can provide insights into intracellular replication and host-pathogen interactions specific to F. tularensis subsp. mediasiatica.

How can researchers effectively analyze the interaction between YidC and YibN in membrane protein insertion?

Effective analysis of YidC-YibN interactions requires multiple complementary approaches:

  • In vitro binding assays: Purified YidC and YibN can be analyzed using blue-native PAGE to visualize complex formation. Structure-function studies, such as deletion of the YibN transmembrane segment (residues 1-29), can identify domains essential for interaction .

  • Co-expression systems: Expressing YibN with YidC substrates allows assessment of YibN's effect on substrate production and membrane insertion. Time-course experiments collecting samples every 15 minutes after induction can track the kinetics of this process .

  • Lipid analysis: Thin-layer chromatography (TLC) can quantify the effect of YibN on membrane lipid production, with phosphoethanolamine (PE) and phosphoglycerol (PG) being predominant species to monitor .

  • Membrane morphology analysis: Transmission electron microscopy of cells stained with appropriate contrast agents can reveal YibN-induced membrane proliferation, circumvolutions, and multilayered structures .

  • Quantitative proteomics: SILAC-based quantitative proteomics following affinity purification can identify proteins enriched in YidC-YibN complexes compared to controls .

How does the genome of F. tularensis subsp. mediasiatica compare to other Francisella subspecies, and what are the implications for pathogenicity?

  • Convergent evolution: The five major genetic branches of F. tularensis, including mediasiatica, have converged along independent routes toward a common gene set through independent losses of gene functions . This suggests that reduced genome size and specialized gene content are adaptive for the highly virulent F. tularensis subspecies.

  • Insertion sequence (IS) elements: Random insertions of IS elements have provided raw materials for secondary adaptive mutations in F. tularensis, including duplication of the Francisella Pathogenicity Island and multiplication of a putative glycosyl transferase gene . These IS-mediated genomic changes may contribute to mediasiatica's unique virulence profile.

  • Recombination patterns: Unlike F. novicida and F. philomiragia, which show signs of homologous recombination in approximately 19.2% of their genes, F. tularensis genomes (including mediasiatica) display no evidence of such recombination . This suggests a more specialized, host-adapted lifestyle for F. tularensis subsp. mediasiatica.

  • Selection patterns: F. tularensis subspecies, including mediasiatica, are characterized by clonal structure with weak purifying selection, whereas F. novicida exhibits more frequent recombination and strong purifying selection . These different evolutionary pressures likely influence the virulence mechanisms of each subspecies.

The genomic features of F. tularensis subsp. mediasiatica likely explain its intermediate virulence profile, combining characteristics from both the highly virulent subsp. tularensis and the moderately virulent subsp. holarctica .

How do YidC-mediated membrane protein insertion mechanisms differ between F. tularensis subsp. mediasiatica and other bacterial pathogens?

While specific data on YidC in F. tularensis subsp. mediasiatica is limited in the provided search results, general principles of YidC function can be applied to understand potential differences:

  • Substrate specificity: YidC exhibits some variation in substrate preference across bacterial species. In F. tularensis subsp. mediasiatica, YidC likely processes species-specific virulence factors in addition to conserved membrane proteins like ATP synthase subunit c .

  • Interacting partners: The YidC-YibN interaction appears to be an important regulatory mechanism for membrane protein insertion . Species-specific variations in YibN structure or expression could influence YidC function in F. tularensis subsp. mediasiatica.

  • Environmental adaptation: Given that F. tularensis subsp. mediasiatica is found primarily in Central Asia and Russia , its YidC-mediated membrane protein insertion mechanisms may be adapted to the specific environmental conditions or host ranges in these regions.

  • Virulence contribution: Since F. tularensis subsp. mediasiatica occupies an intermediate position in virulence , its YidC-mediated membrane protein insertion might contribute to this specific virulence profile through the processing of subspecies-specific virulence factors.

  • Evolutionary constraints: The clonal structure and weak purifying selection observed in F. tularensis might influence the evolution of YidC function in subsp. mediasiatica compared to bacteria with different evolutionary patterns.

What are the key differences in experimental handling and biosafety considerations between F. tularensis subsp. mediasiatica and other subspecies?

F. tularensis subsp. mediasiatica presents distinct experimental handling and biosafety considerations compared to other subspecies:

  • Biosafety classification: Given its intermediate virulence position between subsp. tularensis (BSL-3) and subsp. holarctica (typically BSL-2/3), F. tularensis subsp. mediasiatica should be handled in BSL-3 facilities due to its pathogenicity in mice comparable to subsp. tularensis .

  • Geographic restriction: Since F. tularensis subsp. mediasiatica is found primarily in Central Asia and Russia , researchers outside these regions may have limited access to wild-type isolates, necessitating collaboration with institutions in these regions.

  • Vaccination protection: Experimental evidence shows that live vaccines do not fully protect mice from subsp. mediasiatica but completely protect guinea pigs for at least six months . This differential protection has implications for laboratory worker safety and suggests that vaccinated personnel may still require full BSL-3 precautions when working with this subspecies.

  • Cross-protection studies: When conducting studies involving multiple subspecies, researchers should be aware that immunity to one subspecies may not confer equal protection against F. tularensis subsp. mediasiatica .

  • Animal model selection: The choice of animal model significantly impacts virulence assessment for F. tularensis subsp. mediasiatica, with mice showing susceptibility patterns similar to subsp. tularensis infection and guinea pigs showing patterns more similar to subsp. holarctica infection . This necessitates careful consideration when designing experiments and interpreting results.

What are the most promising approaches for developing vaccines against F. tularensis subsp. mediasiatica?

Based on current understanding of F. tularensis subsp. mediasiatica, several promising vaccine development approaches emerge:

  • Attenuated live vaccines: Current live vaccines provide complete protection in guinea pigs but not mice against subsp. mediasiatica . Developing strain-specific attenuated vaccines that maintain protective antigens while eliminating virulence factors could improve cross-protection.

  • Subunit vaccines targeting conserved antigens: Identifying antigens conserved across subspecies but sufficiently immunogenic to provide protection against subsp. mediasiatica could overcome the limitations of current vaccines.

  • Animal model optimization: Since protection varies between animal models , developing standardized models that better predict human protection would facilitate vaccine development.

  • Adjuvant formulations: Novel adjuvant formulations specifically designed to enhance immune responses against F. tularensis subsp. mediasiatica antigens might improve vaccine efficacy.

  • Duration of immunity studies: Current data shows protection for up to six months in guinea pigs , but longer-term studies are needed to determine the duration of vaccine-induced immunity against subsp. mediasiatica.

How might inhibition of YidC-YibN interactions be exploited for novel antimicrobial development?

The YidC-YibN interaction represents a potential target for novel antimicrobial development:

  • Structure-based drug design: Determining the precise interaction interface between YidC and YibN, particularly involving the YibN transmembrane segment (residues 1-29) that is essential for complex formation , could guide the design of small-molecule inhibitors.

  • Membrane disruption: YibN overexpression stimulates membrane lipid production and promotes inner membrane proliferation . Compounds that interfere with this process could destabilize bacterial membranes and enhance the efficacy of existing antibiotics.

  • Substrate-specific targeting: YibN enhances the production and membrane insertion of YidC substrates . Identifying and targeting subspecies-specific substrates essential for F. tularensis subsp. mediasiatica virulence could provide selective antimicrobial activity.

  • Combination therapies: Inhibitors of YidC-YibN interactions could be developed as adjuvants to conventional antibiotics, potentially enhancing their efficacy by compromising membrane integrity.

  • Screening approaches: High-throughput screening of compound libraries for molecules that disrupt YidC-YibN interactions, as measured by techniques like blue-native PAGE , could identify lead compounds for further development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.