Recombinant Francisella tularensis subsp. mediasiatica Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

Recombinant Francisella tularensis subsp. mediasiatica prolipoprotein diacylglyceryl transferase (Lgt) is an enzymatically active, recombinant protein engineered for research purposes. Lgt catalyzes the transfer of diacylglycerol (DAG) to the N-terminal cysteine residue of prolipoproteins, initiating their maturation and targeting to bacterial membranes . While the query specifies subsp. mediasiatica, available literature and commercial products (e.g., ELISA reagents) primarily reference subsp. novicida (e.g., strain U112, Uniprot ID: A0Q7B3) . This discrepancy suggests potential nomenclature errors or subspecies-specific research gaps.

Key Features of Recombinant Lgt (Subsp. Novicida Example):

ParameterDetails
Source OrganismFrancisella tularensis subsp. novicida (strain U112)
Protein Length268 amino acids
Expression HostE. coli or insect cells (e.g., Expi293F™ for recombinant production)
Storage BufferTris-based buffer with 50% glycerol, stored at -20°C or -80°C
FunctionDiacylation of prolipoproteins, critical for outer membrane protein sorting

Amino Acid Sequence (Partial):
mLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFY...
(Full sequence available via Uniprot ID A0Q7B3)

Genetic Context and Essentiality

Lgt is part of the lipoprotein maturation pathway in Gram-negative bacteria, including Francisella tularensis. This pathway involves:

  1. Lgt: Diacylates prolipoproteins.

  2. LspA: Cleaves the signal peptide.

  3. Lnt: Triacylates mature lipoproteins (non-essential in some Francisella subspecies) .

Essentiality of Lgt in Francisella Pathogens:

  • Transposon mutagenesis studies in F. tularensis Schu S4 and F. novicida confirm lgt as an essential gene . Deletion mutants in lgt or lspA are unviable under standard growth conditions.

  • Lgt’s role in lipoprotein maturation is indispensable for bacterial viability, as lipoproteins are critical for outer membrane integrity and virulence .

Lipoprotein Processing Studies

In F. tularensis, Lgt-mediated diacylation is required for proper lipoprotein targeting. For example:

  • Tul4A (LpnA) and Tul4B (LpnB), two outer membrane lipoproteins, remain functional even when triacylation (via Lnt) is disrupted . This suggests that diacylation alone may suffice for sorting in some Francisella strains.

  • Structural studies on Lgt homologs (e.g., E. coli Lgt) reveal a conserved fold critical for DAG binding and catalysis .

Diagnostic and Vaccine Development

Recombinant Lgt is used in ELISA assays to detect Francisella antigens, though commercial kits typically target other proteins (e.g., FopA) .

Example: Recombinant Lgt in ELISA Development

ApplicationDetails
Antigen SourceRecombinant Lgt expressed in E. coli or insect cells
Detection Limit~0.066–0.074 ng/mL in human serum, mouse urine, or soil water
Cross-ReactivityLimited to Francisella subspecies; matrix interference minimal

Subspecies-Specific Considerations

The term subsp. mediasiatica is not recognized in current Francisella taxonomy. Available data pertain to:

  • Subsp. tularensis: Virulent human pathogen.

  • Subsp. novicida: Less virulent, used as a model organism.

  • Subsp. holarctica: Attenuated, used in live vaccines .

Key Research Gaps:

  1. Lgt in subsp. mediasiatica: No peer-reviewed studies or commercial products explicitly reference this subspecies.

  2. Functional Divergence: Comparative studies of Lgt across Francisella subspecies are lacking.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
lgt; FTM_0715; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Francisella tularensis subsp. mediasiatica (strain FSC147)
Target Names
lgt
Target Protein Sequence
MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFY VALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFIGVLIAFALFARKIGAN FFDLGEFIAPVIPIGLGAGRIGNFINGELWGKVTDSPLGMVFPTGGPLPRYPSQLFEFFF EGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGCARFICEFFRQPDPQYGYIFFNWMTMGQI LSIPMILLGAVILIAVFIKTRKNKCENI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: ftm:FTM_0715

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in Francisella tularensis?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential membrane enzyme in F. tularensis that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This post-translational modification is critical for proper anchoring of bacterial lipoproteins to the membrane. The enzyme is encoded by the lgt gene and is classified with the EC number 2.4.99.- . In F. tularensis, lgt plays a crucial role in bacterial physiology and virulence by ensuring proper localization and function of numerous lipoproteins involved in nutrient acquisition, cell envelope integrity, and host-pathogen interactions.

What are the structural features of F. tularensis lgt that impact its function?

F. tularensis lgt is a membrane-embedded protein with multiple transmembrane domains. The amino acid sequence from F. tularensis subsp. tularensis (SCHU S4 strain) reveals a protein of 268 amino acids with characteristic hydrophobic regions that anchor the protein in the cell membrane . Key structural elements include:

  • Hydrophobic transmembrane helices enabling membrane insertion

  • Catalytic residues involved in the transferase activity

  • Substrate recognition motifs that interact with prolipoprotein substrates

  • Conserved regions that maintain the three-dimensional structure required for enzymatic function

These structural features are crucial determinants of enzyme specificity and activity, with minor variations potentially affecting substrate preference and catalytic efficiency among different F. tularensis subspecies.

What are the optimal conditions for expressing recombinant F. tularensis subsp. mediasiatica lgt?

Optimal expression of recombinant F. tularensis subsp. mediasiatica lgt requires careful consideration of expression systems, growth conditions, and purification strategies:

Expression System Selection:

  • Escherichia coli BL21(DE3) cells are commonly used for initial expression attempts

  • For membrane proteins like lgt, specialized E. coli strains such as C41(DE3) or C43(DE3) may yield better results by accommodating membrane protein overexpression

  • Baculovirus expression systems can be employed for higher yields of properly folded protein

Expression Conditions:

  • Induction with 0.1-0.5 mM IPTG at lower temperatures (16-25°C) often improves solubility

  • Inclusion of membrane-mimicking detergents (DDM, LDAO) in lysis buffers helps maintain native conformation

  • Addition of 10% glycerol to all buffers enhances protein stability during purification

Purification Strategy:

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using appropriate detergents

  • Affinity chromatography using histidine or other fusion tags

  • Size exclusion chromatography for final polishing

For storage, the recombinant protein should be kept in a Tris-based buffer with 50% glycerol at -20°C, with long-term storage at -80°C recommended to maintain activity .

What methods are most effective for verifying the identity and activity of recombinant lgt?

Multiple complementary approaches should be employed to verify both the identity and activity of recombinant lgt:

Identity Verification Methods:

  • SDS-PAGE analysis to confirm molecular weight

  • Western blotting with anti-lgt antibodies or tag-specific antibodies

  • Mass spectrometry for accurate mass determination and peptide mapping

  • N-terminal sequencing to confirm the correct initiation site

Activity Assays:

  • In vitro diacylglyceryl transferase assay using synthetic prolipoproteins as substrates

  • Fluorescence-based assays monitoring lipid transfer to labeled peptides

  • Complementation studies in lgt-deficient bacterial strains

  • Circular dichroism spectroscopy to verify proper protein folding

When testing enzymatic activity, it's crucial to include both positive controls (known active lgt preparations) and negative controls (heat-inactivated enzyme or samples containing inhibitors) to validate assay specificity and sensitivity.

How can researchers effectively culture F. tularensis for extraction of native lgt?

Culturing F. tularensis requires specialized facilities due to its status as a potential bioterrorism agent (especially subsp. tularensis). For laboratory work with F. tularensis, including subsp. mediasiatica:

Biosafety Considerations:

  • Work must be conducted in appropriate biosafety containment (BSL-3 for most subspecies)

  • All personnel must receive proper training and use appropriate personal protective equipment

Culture Methods:

  • Enriched cysteine heart agar blood (CHAB) culture medium provides optimal growth conditions

  • For contaminated specimens, antibiotic-supplemented CHAB (CHAB-A) improves recovery by up to 81.1%

  • Incubation at 37°C with 5% CO2 for 3-5 days typically yields sufficient growth

  • Chocolate agar plates represent a commercially available alternative for laboratory culture

Sample Processing:

  • Fresh tissues yield the highest culture recovery rates (up to 90%)

  • For transport, immediate freezing provides recovery rates as high as 94%

  • Samples for culture should be obtained before initiating antibiotic treatment

Native Protein Extraction:

  • Bacterial cells should be harvested during late exponential phase

  • Gentle lysis methods help preserve membrane protein integrity

  • Differential centrifugation separates membrane fractions containing lgt

These culture methods have been validated primarily for F. tularensis subsp. holarctica and tularensis but are expected to be applicable to subsp. mediasiatica due to their similar growth requirements .

How does lgt from F. tularensis subsp. mediasiatica compare genomically to that from other subspecies?

The genomic context and characteristics of lgt in F. tularensis subsp. mediasiatica show important similarities and differences compared to other subspecies:

FeatureF. tularensis subsp. mediasiaticaF. tularensis subsp. tularensisF. tularensis subsp. holarcticaF. novicida
Gene length (bp)~807~807~807~807
Protein length (aa)268268268268
Nucleotide identityReference>97%>97%~95%
Amino acid identityReference>98%>98%~94%
Genetic neighborhoodConservedConservedConservedSome differences
Evidence of recombinationNone detectedNone detectedNone detectedPresent

F. tularensis subsp. mediasiatica lgt shows high conservation with other F. tularensis subspecies, reflecting the essential nature of this enzyme . Unlike F. novicida, which shows signs of homologous recombination in approximately 19.2% of genes, F. tularensis subspecies (including mediasiatica) show no evidence of recombination in the lgt gene, indicating strong purifying selection and a clonal population structure . This genomic stability may reflect adaptation to specialized intracellular habitats and strict host ranges.

What role does lgt play in the pathogenesis and host adaptation of F. tularensis?

Lgt plays several critical roles in F. tularensis pathogenesis and host adaptation:

  • Lipoprotein Processing: By catalyzing the first step in lipoprotein maturation, lgt ensures proper localization of numerous virulence-associated lipoproteins.

  • Immune Modulation: Properly processed lipoproteins interact with host pattern recognition receptors, particularly Toll-like receptor 2 (TLR2), potentially contributing to the unique immunomodulatory properties of F. tularensis.

  • Intracellular Survival: Lipoproteins processed by lgt contribute to membrane integrity and nutrient acquisition within host cells, supporting the intracellular lifestyle that characterizes F. tularensis pathogenesis.

  • Host Adaptation: The evolutionary convergence observed across F. tularensis subspecies suggests that lgt function has been preserved during adaptation to mammalian hosts . Unlike F. novicida and F. philomiragia, which have less specialized lifecycles, F. tularensis subspecies (including mediasiatica) show genomic signatures of adaptation to intracellular habitats, with lgt likely contributing to this specialization.

  • Stress Response: Properly processed lipoproteins contribute to bacterial survival under various stress conditions encountered within hosts.

The conservation of lgt among clinically relevant F. tularensis subspecies, combined with its absence in mammalian cells, makes it a potential target for antimicrobial development and diagnostic applications.

How can recombinant lgt be used in diagnostic assays for tularemia?

Recombinant F. tularensis lgt offers several applications in diagnostic assay development:

ELISA-Based Detection Systems:

  • Recombinant lgt can serve as an antigen in enzyme-linked immunosorbent assays

  • Anti-lgt antibodies can be detected in patient sera during acute and convalescent phases of infection

  • Rising antibody titers between paired samples provide confirmatory diagnosis

Molecular Diagnostics:

  • PCR assays targeting the lgt gene can distinguish F. tularensis from other bacterial species

  • Subspecies-specific polymorphisms in lgt can be exploited for differentiation of F. tularensis subspecies using qPCR or sequencing approaches

  • Multiplexed assays incorporating lgt alongside other genetic markers enhance specificity

Advantages of lgt-Based Diagnostics:

  • High conservation within F. tularensis subspecies provides reliable detection

  • Subspecies-specific variations allow discrimination between different forms of tularemia

  • Unique sequence features distinguish F. tularensis from environmental Francisella species and endosymbionts

When developing diagnostic assays using recombinant lgt, researchers should include appropriate controls and validate assay performance against culture-confirmed cases representing different F. tularensis subspecies and disease presentations.

What are the main technical challenges in working with recombinant F. tularensis lgt?

Researchers face several significant challenges when working with recombinant F. tularensis lgt:

Expression and Purification Challenges:

  • Membrane protein nature complicates expression, often resulting in inclusion body formation

  • Maintaining native conformation during solubilization and purification requires careful detergent selection

  • Low expression yields may necessitate optimization of codon usage and expression conditions

  • Lipid environment requirements for optimal activity may be difficult to replicate in vitro

Functional Assay Limitations:

  • Identifying appropriate synthetic substrates that mimic natural prolipoproteins

  • Developing robust activity assays with appropriate sensitivity and specificity

  • Distinguishing lgt activity from other lipid modification processes in complex systems

  • Correlating in vitro enzymatic activity with biological function

Biosafety Considerations:

  • Work with virulent F. tularensis strains requires BSL-3 containment

  • Limited availability of F. tularensis subsp. mediasiatica strains

  • Regulatory restrictions on F. tularensis research due to bioterrorism concerns

  • Challenges in transferring materials between institutions

These technical obstacles necessitate interdisciplinary approaches combining protein biochemistry, molecular biology, and structural biology techniques to advance our understanding of F. tularensis lgt.

What evolutionary insights can be gained from studying F. tularensis subsp. mediasiatica lgt?

Studying lgt from F. tularensis subsp. mediasiatica provides valuable evolutionary insights:

  • Evolutionary Trajectory: F. tularensis subsp. mediasiatica represents an intermediate evolutionary stage between the highly virulent subsp. tularensis and the moderately virulent subsp. holarctica . Analysis of lgt sequence and function across these subspecies can illuminate the molecular basis of virulence evolution.

  • Selective Pressures: The absence of homologous recombination in F. tularensis subspecies, contrasted with its presence in F. novicida (~19.2% of genes), suggests different selective pressures . Lgt evolution reflects this broader pattern, with F. tularensis showing weak purifying selection and F. novicida demonstrating strong purifying selection.

  • Convergent Evolution: The five major genetic branches of F. tularensis appear to have converged independently toward a common gene set, with lgt representing a core function maintained throughout this convergence . This suggests that lgt function is critical for the specialized lifestyle of F. tularensis.

  • Host Adaptation Signatures: Comparing lgt sequences and activities across Francisella species with different host ranges (from predominantly environmental species to strict mammalian pathogens) can reveal molecular adaptations associated with host specialization.

  • Genomic Context Changes: Analyzing the genomic neighborhood of lgt across subspecies may reveal insertion sequence element activity and other genomic rearrangements that characterize F. tularensis evolution.

These evolutionary analyses contribute to our broader understanding of bacterial pathogen evolution and host adaptation mechanisms.

What are promising future research directions for F. tularensis lgt studies?

Future research on F. tularensis lgt should focus on several promising areas:

Structural Biology Approaches:

  • Determination of high-resolution crystal or cryo-EM structures of lgt from different F. tularensis subspecies

  • Comparative structural analysis to identify subspecies-specific features

  • Structure-guided design of specific inhibitors as potential antimicrobial agents

Systems Biology Integration:

  • Comprehensive identification of lgt substrates in F. tularensis using proteomics approaches

  • Integration of lgt function with broader lipoprotein processing pathways

  • Network analysis of lgt-dependent processes during infection

Immunological Applications:

  • Exploration of lgt-processed lipoproteins as vaccine candidates

  • Investigation of host immune responses to lgt-modified antigens

  • Development of subunit vaccines incorporating recombinant lgt-processed lipoproteins

Therapeutic Development:

  • High-throughput screening for lgt inhibitors with antimicrobial activity

  • Structure-activity relationship studies of lead compounds

  • In vivo validation of lgt as a therapeutic target in animal models of tularemia

Diagnostic Advancement:

  • Development of multiplexed diagnostic platforms incorporating lgt detection

  • Point-of-care assays based on lgt-specific antibodies or nucleic acid detection

  • Validation of lgt-based diagnostics across diverse clinical presentations and F. tularensis subspecies

Progress in these research directions would significantly advance our understanding of F. tularensis biology and potentially lead to improved diagnostic, preventive, and therapeutic approaches for tularemia.

What controls should be included when studying F. tularensis lgt function?

Robust experimental design for studying F. tularensis lgt function requires comprehensive controls:

Positive Controls:

  • Known active lgt preparations from model organisms (E. coli, B. subtilis)

  • Validated substrate peptides with established diacylglyceryl modification patterns

  • Characterized F. tularensis lipoproteins with confirmed lgt-dependent processing

Negative Controls:

  • Heat-inactivated lgt enzyme preparations

  • Site-directed mutants targeting catalytic residues

  • Substrate peptides with modified lipobox sequences that prevent recognition

  • Lgt preparations treated with specific inhibitors

Specificity Controls:

  • Related transferases from the lipoprotein processing pathway

  • Lgt proteins from closely related Francisella species

  • Peptide substrates with scrambled recognition sequences

System Controls:

  • Membrane-mimicking environments without lgt protein

  • Buffer components matched to experimental conditions

  • Vehicle controls for any solvents or additives used

Inclusion of these controls ensures that observed effects are specifically attributable to lgt activity and facilitates meaningful comparisons across experimental conditions and F. tularensis subspecies.

How can researchers address data discrepancies in F. tularensis lgt studies?

When confronted with data discrepancies in F. tularensis lgt research, researchers should implement a systematic troubleshooting approach:

  • Verify Protein Identity and Integrity:

    • Confirm protein sequence through mass spectrometry

    • Assess protein folding and stability using biophysical methods

    • Check for degradation or aggregation using SDS-PAGE and size exclusion chromatography

  • Evaluate Experimental Conditions:

    • Test multiple buffer systems and pH conditions

    • Vary detergent types and concentrations

    • Assess temperature dependence of observed activities

    • Consider effects of freeze-thaw cycles on protein activity

  • Cross-Validate with Multiple Methods:

    • Use orthogonal activity assays to confirm observations

    • Apply both in vitro biochemical assays and cell-based functional studies

    • Combine genetic approaches (knockout/complementation) with biochemical characterization

  • Address Biological Variability:

    • Consider strain-specific variations in lgt sequence and expression

    • Account for growth phase-dependent changes in lgt activity

    • Evaluate host cell type effects in infection models

  • Statistical Approaches:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests based on data distribution

    • Use power analysis to determine adequate sample sizes

Transparent reporting of discrepancies and comprehensive description of methodological details facilitate collaborative problem-solving in the scientific community.

What methodological approaches are recommended for studying lgt interactions with host immune systems?

Studying interactions between F. tularensis lgt-processed lipoproteins and host immune systems requires multifaceted methodological approaches:

In Vitro Immune Cell Studies:

  • Stimulation of macrophages, dendritic cells, and neutrophils with purified recombinant lgt or lgt-processed lipoproteins

  • Flow cytometry analysis of activation markers and cytokine production

  • RNA-seq or transcriptomics to identify immune response pathways

  • ELISA-based cytokine profiling to characterize inflammatory responses

Ex Vivo Tissue Models:

  • Precision-cut lung slices exposed to lgt-processed lipoproteins

  • Organoid cultures representing target tissues (lung, liver, spleen)

  • Tissue explant cultures to assess tissue-specific responses

In Vivo Approaches:

  • Comparison of wild-type F. tularensis with lgt mutants in animal infection models

  • Use of immune-deficient mice (e.g., TLR2-/-, MyD88-/-) to delineate signaling pathways

  • Adoptive transfer experiments to identify key responding cell populations

  • In vivo imaging to track inflammatory responses to lgt-processed lipoproteins

Human Studies:

  • Analysis of patient serum for antibodies against lgt-processed lipoproteins

  • Ex vivo stimulation of human PBMCs with recombinant proteins

  • Correlation of immune responses with clinical outcomes

These methodological approaches should be integrated to provide a comprehensive understanding of how lgt-dependent lipoprotein processing contributes to F. tularensis pathogenesis and host immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.