Recombinant Francisella tularensis subsp. novicida Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

PlsY is an acyltransferase (EC 2.3.1.n3) that catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid—a precursor for phospholipid biosynthesis . In Francisella tularensis subsp. novicida, this enzyme is encoded by the plsY gene (locus tag: FTN_1105) and is essential for membrane lipid assembly .

Key Features:

  • Catalytic Activity: Converts G3P and acyl-phosphate to lysophosphatidic acid .

  • Gene Location: Chromosomal gene FTN_1105 in F. tularensis subsp. novicida U112 .

  • Protein Structure: 204 amino acids (UniProt ID: A0Q6X6), fused with an N-terminal His tag for purification .

Research Applications

Recombinant PlsY is utilized in:

  • Enzyme Kinetics: Characterizing substrate specificity and catalytic efficiency .

  • Antibody Development: Generating polyclonal antibodies for diagnostic assays .

  • Structural Studies: Analyzing membrane protein interactions via X-ray crystallography or cryo-EM .

Production and Purification Workflow

  1. Cloning: plsY gene amplified from F. tularensis subsp. novicida U112 and inserted into pET vector .

  2. Expression: Induced with IPTG in E. coli BL21(DE3) .

  3. Purification: Ni-NTA affinity chromatography under denaturing/native conditions .

Yield and Stability:

  • Typical yield: 0.5–1.0 mg/L culture .

  • Stable for 6 months at -80°C; avoid freeze-thaw cycles .

Related Research Context

While PlsY itself is not directly linked to virulence, Francisella lipid metabolism is intertwined with pathogenesis:

  • Membrane Biogenesis: Altered lipid composition affects bacterial survival in macrophages .

  • Regulatory Networks: Transcription factors like MglA-SspA govern virulence genes, though PlsY is not part of this cluster .

Comparative Analysis of Francisella Acyltransferases:

ProteinFunctionVirulence Role
PlsYPhospholipid biosynthesisEssential for growth
FopAOuter membrane assemblyProtective antigen in mice
PglAGlycosyltransferaseRequired for pilin glycosylation

Sources:

Future Directions

  • Structural Resolution: Cryo-EM studies to map active sites.

  • Drug Targeting: Screen inhibitors to disrupt Francisella lipid biosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; FTN_1105; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Francisella tularensis subsp. novicida (strain U112)
Target Names
plsY
Target Protein Sequence
MNFLNFSILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGKVPAAITLI FDILKGLVPVVIAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGVATLIGTLFGFSW ILGLIFVITWLCVAIITRYSSLSALVATVIASFSVIFTSDLQVAAPFLIIAIIILVKHKG NIQRLISGQESKIGDKAKAKNDSN
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), yielding lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links

KEGG: ftn:FTN_1105

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Glycerol-3-phosphate acyltransferase (plsY) in Francisella tularensis?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first step in membrane phospholipid biosynthesis, transferring an acyl group from acyl-acyl carrier protein (acyl-ACP) to glycerol-3-phosphate. This reaction generates lysophosphatidic acid, a critical intermediate in bacterial membrane formation. In F. tularensis, membrane integrity is essential for survival both within host cells and in the environment.

Similar to other bacterial membrane-associated proteins in F. tularensis, plsY likely contributes to the unique cell envelope properties that enable pathogen survival. The bacterial cell wall is a dynamic structure constantly remodeled during growth and division by various enzymes . Analogous to other F. tularensis membrane-associated proteins, plsY may represent a potential target for therapeutic development due to the bacterium's apparent lack of redundancy in certain enzymatic functions .

How does F. tularensis subsp. novicida relate to other Francisella subspecies?

F. tularensis subsp. novicida is one of five subspecies found in the Northern hemisphere alongside subsp. tularensis and subsp. holarctica, which are the main causes of human disease . While F. tularensis subsp. novicida is less virulent in humans, it serves as an important laboratory model for investigating Francisella biology for several reasons:

SubspeciesHuman VirulenceBiosafety LevelGenome SimilarityResearch Utility
F. tularensis subsp. tularensisHigh (50% mortality untreated)BSL-3Reference strainLimited by containment requirements
F. tularensis subsp. holarcticaModerateBSL-3Highly similarLimited by containment requirements
F. tularensis subsp. novicidaLowBSL-2Conserved virulence mechanismsPreferred laboratory model

F. tularensis subsp. novicida shares significant genetic similarity with the more virulent subspecies while being manipulable under less stringent biosafety conditions, making it valuable for basic research into conserved Francisella proteins like plsY .

What experimental approaches are used to identify essential enzymes in F. tularensis?

Researchers employ several strategies to determine whether enzymes like plsY are essential:

  • Gene disruption: Creating targeted gene knockouts and assessing viability.

  • Transposon mutagenesis: Generating libraries of random insertional mutants and identifying genes that cannot be disrupted.

  • Conditional expression systems: Placing the gene under an inducible promoter to control expression levels.

  • Complementation studies: Reintroducing the gene to restore function in a mutant strain.

The lack of genetic redundancy in F. tularensis enzymes makes them potentially essential, unlike in many bacterial species that encode multiple enzymes with redundant functions . For example, studies of the glycolytic enzyme GapA demonstrated that while the mutant was viable (indicating non-essentiality), it displayed growth defects when amino acids became limiting, suggesting metabolic pathway interdependence .

What expression systems are optimal for recombinant F. tularensis plsY production?

When expressing recombinant F. tularensis proteins, researchers must consider several factors affecting yield, solubility, and biological activity:

Expression SystemAdvantagesDisadvantagesModifications for Membrane Proteins
E. coli BL21(DE3)High yield, simple cultivationMay form inclusion bodiesFusion tags (MBP, SUMO); lower temperature (16-20°C)
E. coli C41/C43Engineered for membrane proteinsLower yield than BL21Extended induction at 20°C
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldSupplementation with lipids/detergents

For membrane-associated proteins like plsY, E. coli expression systems using strains specifically designed for membrane protein expression have proven successful for similar Francisella proteins. For example, the outer membrane protein FopA was successfully expressed in E. coli and purified from the bacterial outer membrane . The recombinant protein maintained proper folding and antigenicity, as demonstrated by its recognition by antibodies and ability to induce immune responses .

What purification strategies yield highest purity and activity of recombinant membrane-associated proteins?

Membrane proteins require specialized purification approaches:

  • Membrane fraction isolation: Differential centrifugation followed by selective extraction.

  • Detergent selection: Screening multiple detergents to maintain protein stability.

  • Affinity chromatography: Utilizing His-tags or other fusion tags for initial capture.

  • Size exclusion chromatography: Further purification and buffer exchange.

For Francisella membrane proteins, researchers have successfully employed affinity purification methods. In studying FopA, researchers isolated the protein from the E. coli outer membrane using affinity purification, which yielded functional protein that could be incorporated into liposomes . Similarly, GapA was successfully isolated from both whole-cell lysates and culture filtrate proteins while maintaining enzymatic activity, demonstrating the importance of assessing multiple cellular fractions .

How can protein activity be verified after purification?

Confirming enzymatic activity of purified plsY typically involves:

  • Enzymatic assays: Measuring the transfer of acyl groups to glycerol-3-phosphate.

  • Biophysical characterization: Circular dichroism to confirm proper folding.

  • Mass spectrometry: Verifying protein integrity and modifications.

For example, researchers studying GapA from F. tularensis verified enzyme activity by measuring NADH formation coupled to glyceraldehyde-3-phosphate oxidation. This approach demonstrated that both recombinant GapA and the native enzyme from bacterial extracts maintained catalytic function after purification . Typical enzymatic assay results may appear as follows:

Sample TypeEnzyme ConcentrationSubstrate ConcentrationSpecific Activity (μmol/min/mg)
Purified recombinant protein5 μg1 mMHighest activity
Purified recombinant protein2.5 μg1 mMProportional reduction
Purified recombinant protein1 μg1 mMProportional reduction
Whole-cell lysate50 μg total protein1 mMDetectable activity
Culture filtrate50 μg total protein1 mMDetectable activity

These approaches confirm that the purified protein maintains its native catalytic properties .

What methods are effective for generating targeted gene deletions in F. tularensis?

Creating genetic modifications in F. tularensis requires specialized approaches:

  • Suicide vector systems: Non-replicating plasmids carrying homologous regions flanking the target gene.

  • Selection markers: Antibiotic resistance genes for positive selection.

  • Counter-selection strategies: Genes like sacB for selecting double recombination events.

  • Cre-lox systems: For generating markerless deletions.

When generating gene deletions in Francisella, researchers must confirm the absence of polar effects on surrounding genes through complementation studies. For the GapA enzyme, researchers demonstrated that the specific phenotype observed in the ΔgapA mutant was fully complemented when the gene was reintroduced, confirming the phenotype resulted directly from GapA absence rather than disruption of nearby genes .

How can researchers address experimental challenges when working with F. tularensis?

Working with F. tularensis presents several challenges:

ChallengeSolutionMethodological Consideration
Biosafety concernsUse of attenuated strains or subsp. novicidaBalance between model relevance and safety
Low transformation efficiencyOptimization of electroporation conditionsSpecialized protocols for Francisella
Genetic tool limitationsAdaptation of tools from other bacterial systemsValidation in Francisella background
Phenotype verificationMulti-approach confirmationGenetic complementation, biochemical assays

When studying essential genes like those involved in cell wall biosynthesis, complete gene deletion may not be possible. Instead, researchers may use approaches such as conditional expression systems or partial deletions. Studies of peptidoglycan enzymes in F. tularensis have revealed their importance for cell division, morphology, and virulence, suggesting they represent valuable targets for therapeutics development .

What controls are necessary when analyzing phenotypes of F. tularensis mutants?

Proper controls are essential for interpreting F. tularensis mutant phenotypes:

  • Wild-type strain: Establishes baseline phenotype.

  • Complemented mutant: Confirms phenotype is due to the targeted gene.

  • Empty vector control: Controls for effects of the vector itself.

  • Related gene mutants: Distinguishes specific vs. general effects.

For example, researchers studying GapA conducted control experiments demonstrating that the growth defect in Chamberlain's medium was specifically related to GapA's role in glycolysis rather than a general growth defect. The mutant grew normally until amino acids were depleted, at which point it could no longer utilize glycolysis effectively for energy production .

What techniques are most informative for determining plsY structure-function relationships?

Multiple complementary approaches provide insights into protein structure-function relationships:

  • X-ray crystallography: Provides high-resolution structural data.

  • Site-directed mutagenesis: Identifies critical residues for catalysis.

  • Molecular dynamics simulations: Models protein behavior in membrane environments.

  • Protein-ligand binding studies: Characterizes substrate interactions.

Studies of membrane proteins in F. tularensis have successfully employed combinations of these approaches. For instance, researchers have characterized multiple localization patterns of GapA in F. tularensis using 2D SDS-PAGE separation followed by immunodetection, revealing its presence in whole-cell lysates, membrane fractions, and culture filtrates .

How does membrane localization affect protein function in F. tularensis?

Membrane localization can significantly impact protein function in Francisella:

LocalizationFunctional ImplicationsDetection MethodsExample Proteins
Inner membraneDirect interaction with cytoplasmMembrane fractionation, fluorescence microscopyTransport proteins
Outer membraneInterface with environment/hostSurface labeling, protease accessibilityFopA
Multiple locationsDiverse functionsComparative proteomicsGapA

Interestingly, some proteins demonstrate unexpected localization patterns. GapA, traditionally considered a cytoplasmic glycolytic enzyme, was detected in membrane fractions and culture filtrates of F. tularensis, suggesting additional non-glycolytic functions potentially related to virulence . This multi-localization phenomenon has been observed for other glycolytic enzymes in pathogenic bacteria.

What approaches can identify protein-protein interactions involving plsY?

Studying protein-protein interactions in Francisella typically involves:

  • Co-immunoprecipitation: Pulls down protein complexes from cell lysates.

  • Bacterial two-hybrid systems: Genetic screening for interactions.

  • Crosslinking mass spectrometry: Identifies interaction interfaces.

  • Split-reporter systems: Visualizes interactions in live cells.

These techniques could help determine whether plsY functions within larger protein complexes involved in membrane biosynthesis, similar to other bacterial systems. Such approaches have helped characterize protein networks in F. tularensis, including those involved in cell wall synthesis and membrane integrity .

How does membrane composition affect F. tularensis pathogenesis?

Membrane composition plays critical roles in Francisella pathogenesis:

  • Host immune evasion: Modified lipopolysaccharide structure reduces TLR recognition.

  • Intracellular survival: Specialized membrane composition resists host defense mechanisms.

  • Biofilm formation: Membrane properties influence environmental persistence.

  • Drug resistance: Altered membrane permeability affects antibiotic susceptibility.

Enzymes involved in membrane biosynthesis, like plsY, may therefore be implicated in virulence. The importance of membrane components in F. tularensis is highlighted by studies of bacterial surface structures like lipopolysaccharide and capsule, which significantly contribute to pathogenesis and immune evasion .

What experimental models are appropriate for studying F. tularensis virulence factors?

Researchers employ various models to study Francisella virulence:

Model SystemApplicationsAdvantagesLimitations
Macrophage infectionIntracellular survivalDirectly studies key host cellsLimited to cellular processes
Murine modelsSystemic disease progressionMammalian immune responseBSL-3 for virulent strains
Insect modelsAlternative infection modelSimplified system, lower biocontainmentLess translatable to humans
Organ-on-chipTissue-specific interactionsHuman cells, controlled environmentNew technology, limited validation

For initial testing of recombinant F. tularensis proteins, researchers have successfully used mouse models. For example, recombinant FopA was incorporated into liposomes and administered to mice to assess its ability to induce protective immune responses against subsequent F. tularensis challenge .

What considerations are important when targeting plsY for therapeutic development?

When evaluating plsY as a therapeutic target, researchers should consider:

  • Essentiality: Determine whether plsY is essential for bacterial viability.

  • Structural uniqueness: Assess structural differences from mammalian homologs.

  • Druggability: Evaluate the presence of targetable binding pockets.

  • Resistance potential: Consider the likelihood of resistance development.

F. tularensis peptidoglycan enzymes have been identified as promising therapeutic targets because the bacterium appears to lack redundancy in these functions, suggesting they may be essential and therefore valuable targets for the development of novel therapeutics . Similar considerations would apply to membrane biosynthesis enzymes like plsY.

How do environmental conditions affect plsY expression and activity?

Environmental factors can significantly influence enzyme expression and function:

  • Temperature shifts: Mimicking transition between environment and host.

  • Nutrient limitation: Simulating different host compartments.

  • Oxidative stress: Replicating host defense mechanisms.

  • pH changes: Modeling phagosomal environments.

Research on other F. tularensis enzymes has demonstrated environmental responsiveness. For example, GapA expression patterns change under different growth conditions, and the ΔgapA mutant showed specific growth defects when amino acids became limiting, suggesting metabolic adaptation mechanisms .

What role might plsY play in antimicrobial resistance mechanisms?

Membrane biosynthesis enzymes potentially contribute to antimicrobial resistance through:

  • Altered membrane permeability: Restricting drug entry.

  • Modified membrane composition: Reducing antimicrobial binding.

  • Biofilm formation: Creating physical barriers to antibiotics.

  • Persister cell formation: Entering dormant states resistant to antibiotics.

Targeting membrane biosynthesis pathways might provide strategies to overcome antimicrobial resistance. F. tularensis peptidoglycan enzymes have been identified as promising therapeutic targets, suggesting a similar potential for membrane biosynthesis enzymes .

How can systems biology approaches enhance understanding of plsY in cellular networks?

Integrative approaches provide comprehensive understanding of enzyme function:

  • Transcriptomics: Identifies co-regulated genes under various conditions.

  • Proteomics: Maps protein abundance changes and modifications.

  • Metabolomics: Measures metabolic consequences of enzyme modulation.

  • Network analysis: Positions plsY within broader cellular pathways.

Such approaches can reveal unexpected connections between seemingly disparate cellular processes. For example, studies of GapA revealed its presence in multiple cellular compartments, suggesting non-canonical functions beyond glycolysis . Similar multi-functional properties might be discovered for plsY through comprehensive systems biology investigations.

What biosafety precautions are necessary when working with Francisella species?

Appropriate biosafety measures are critical when working with Francisella:

SubspeciesBiosafety LevelRequired ContainmentVaccination Recommendations
F. tularensis subsp. tularensisBSL-3Negative pressure rooms, HEPA filtrationStaff vaccination recommended
F. tularensis subsp. holarcticaBSL-3Negative pressure rooms, HEPA filtrationStaff vaccination recommended
F. tularensis subsp. novicidaBSL-2Biological safety cabinetRisk assessment based
Attenuated strains (LVS)BSL-2Biological safety cabinetRisk assessment based

While F. tularensis Live Vaccine Strain (LVS) is attenuated in humans, it remains virulent in mice and is not approved for vaccine use in the United States due to safety concerns . This highlights the importance of proper risk assessment and appropriate containment measures even when working with attenuated strains.

What methods effectively establish the scientific reproducibility of findings with F. tularensis?

Ensuring reproducibility in Francisella research requires:

  • Detailed methodological reporting: Including strain verification, growth conditions, and genetic characterization.

  • Multiple experimental approaches: Confirming findings through independent methods.

  • Statistical rigor: Appropriate sample sizes and statistical analyses.

  • Data transparency: Sharing raw data and detailed protocols.

Researchers can enhance trustworthiness in qualitative research through the effective use of tables to organize, analyze, and display evidence . Data inventory tables, data sources tables, and data analysis tables can significantly improve transparency in experimental design and execution .

How should researchers approach collaboration when working with select agents like F. tularensis?

Effective collaboration strategies include:

  • Institutional partnerships: Establishing formal agreements between institutions with appropriate facilities.

  • Division of labor: Conducting BSL-3 work at specialized facilities while performing BSL-2 compatible experiments elsewhere.

  • Material transfer protocols: Following strict guidelines for transferring materials between laboratories.

  • Virtual collaboration tools: Utilizing secure data sharing platforms for joint analysis.

These approaches facilitate broader scientific collaboration while maintaining rigorous biosafety standards. The classification of F. tularensis as a category A biothreat pathogen necessitates special consideration for material transfer and information sharing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.