Recombinant Francisella tularensis subsp. novicida Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Francisella tularensis subsp. novicida Membrane Protein Insertase YidC (yidC)

Recombinant Francisella tularensis subsp. novicida Membrane protein insertase YidC (yidC) is a recombinant form of the YidC protein, which is a universally conserved membrane protein insertase found in bacteria. YidC plays a crucial role in the integration of membrane proteins into the bacterial cell membrane, either independently or in conjunction with the SecY complex. This process is essential for the proper functioning of membrane proteins, which are vital for various cellular activities such as transport, signaling, and cell-cell interactions.

Function of YidC in Bacteria

YidC is involved in the co-translational insertion of membrane proteins into the cytoplasmic membrane. It acts as a molecular chaperone, guiding newly synthesized membrane proteins from the ribosome to their correct position within the membrane. This process ensures that membrane proteins are correctly folded and positioned, allowing them to perform their biological functions effectively .

Structure of YidC

Structural models of YidC, based on evolutionary co-variation analysis and molecular dynamics simulations, reveal a distinctive arrangement of five transmembrane domains. A helical hairpin structure between transmembrane segments 2 and 3 is also present on the cytoplasmic membrane surface. This structural arrangement facilitates the interaction of YidC with the ribosome and the insertion of membrane proteins into the lipid bilayer .

Table: Key Features of Recombinant Francisella tularensis subsp. novicida YidC

FeatureDescription
FunctionMembrane protein insertase involved in co-translational insertion of membrane proteins.
StructureFive transmembrane domains with a helical hairpin between TM2 and TM3.
Role in F. tularensis subsp. novicidaEssential for integration of membrane proteins critical for bacterial survival and virulence.
Research ApplicationsStudying membrane protein biogenesis and its implications for bacterial pathogenicity.

Research Implications

  • Membrane Protein Biogenesis: Understanding how YidC integrates membrane proteins can provide insights into bacterial cell membrane assembly and function.

  • Bacterial Pathogenicity: The role of YidC in integrating virulence-related membrane proteins makes it a potential target for developing therapeutic strategies against bacterial infections.

  • Biotechnological Applications: Recombinant YidC can be used in biotechnological applications to improve the expression and stability of membrane proteins in bacterial systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yidC; FTN_0073; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Francisella tularensis subsp. novicida (strain U112)
Target Names
yidC
Target Protein Sequence
MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNSHYDNADSSTNTDVTT TDAKSSLAKETNFSKYDNAKSITINTGVFKDVKVSLLDGAIISASLKDYSISLDDKTPMS LLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKTENGKQILTLTGSADGLQITRTYTFDD TKYNISVSQNIKNTTSAPVNVIVDDSFARDFDPAGDSFSLLNAHSYTFTGVAYSTAKDSF RKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQSTNAKIYYKNLNGDVFEAGA FTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNHIHS LVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETYKDDRQALGKKMM ELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPV LMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFASFPSGLVLYWLTNNLISISQQWI ITRHYQATHKK
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC aids in the folding of multispanning membrane proteins.
Database Links

KEGG: ftn:FTN_0073

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC in bacterial systems?

YidC serves as a membrane protein insertase that mediates the integration of proteins into the cytoplasmic membrane of bacteria. This process typically occurs co-translationally, meaning that proteins are inserted into the membrane as they are being synthesized by the ribosome. YidC can function either independently as a membrane protein insertase or in concert with the SecY complex . The protein facilitates this process by providing a hydrophilic environment within the membrane core that can receive the hydrophilic moieties (termini or loops) of substrate proteins. Additionally, YidC reduces the thickness of the lipid bilayer, which helps overcome the energetic barriers of membrane protein insertion .

How is the YidC protein structurally organized?

The YidC protein possesses a distinctive arrangement of five conserved transmembrane domains (TMDs). In E. coli, the protein contains a helical hairpin structure between transmembrane segment 2 (TM2) and TM3 that sits on the cytoplasmic membrane surface . Molecular dynamics simulations have revealed that while the five transmembrane helices form a rigid protein core, the polar loop regions tend to have greater mobility on the membrane surface . The protein core is stabilized through both short and long-range interactions between the five helices, with the cytoplasmic side featuring primarily polar or charged residues engaged in strong electrostatic interactions, while the periplasmic side contains primarily aromatic residues involved in stacking and nonpolar dispersion interactions .

What expression systems are recommended for producing recombinant YidC?

Based on research methodologies for membrane proteins, several expression systems can be used for recombinant YidC production:

  • Insect cell expression systems: The baculovirus insect cell expression vector system has been successfully used for producing membrane proteins similar to YidC . This system allows for proper post-translational modifications and folding of complex proteins.

  • Mammalian cell expression systems: Expi293F™ cells grown in suspension culture with appropriate expression medium at 37°C in a 70% humid, 5% CO₂ incubator have been employed for membrane protein expression .

  • E. coli-based systems: While not specifically mentioned in the search results for YidC, bacterial expression systems are commonly used for bacterial membrane proteins when proper folding can be achieved.

The choice of expression system should be determined by research needs, including required protein yield, post-translational modifications, and downstream applications.

How can researchers assess the structural stability of recombinant YidC?

Researchers can assess the structural stability of recombinant YidC through several complementary approaches:

  • Molecular Dynamics (MD) simulations: MD simulations have been successfully used to assess the stability of YidC models in membrane environments. These simulations can reveal inter-residue interactions within the transmembrane region that contribute to protein stability .

  • In vivo complementation assays: Creating alanine mutants of key residues and testing their ability to complement YidC function in vivo provides functional validation of structural predictions. For example, mutations of highly stabilizing residues like T362 in TM2 and Y517 in TM6 have been shown to completely inactivate YidC while maintaining protein stability .

  • Protein expression verification: Western blotting can confirm stable expression of the protein and its mutants, distinguishing between activity loss due to structural instability versus functional disruption .

How does YidC interact with the ribosome during co-translational membrane protein insertion?

YidC interacts with the ribosome at the ribosomal tunnel exit through a single monomer. Cryo-electron microscopy reconstructions of YidC-ribosome complexes have revealed that YidC binds to the ribosome at the site where the newly synthesized protein chain emerges . Unlike the SecY complex, which translocates hydrophilic nascent chains through its central aqueous channel and inserts transmembrane domains through a lateral gate, YidC appears to facilitate insertion at the protein-lipid interface .

The mechanism involves two key features:

  • YidC provides a hydrophilic environment within the membrane core for receiving the hydrophilic moieties (termini or loops) of substrate proteins.

  • It reduces the thickness of the lipid bilayer, which lowers the energetic barrier for insertion.

This arrangement allows for partial insertion of hydrophilic regions into the membrane while facilitating exposure of hydrophobic transmembrane domains to the lipid bilayer core. The hydrophobic interactions between transmembrane domains and the lipid environment may compensate for the energetic cost of moving hydrophilic regions across the thinned bilayer .

What methodological approaches can be used to study YidC-substrate interactions?

Several methodological approaches are effective for studying YidC-substrate interactions:

  • Covariation analysis: This technique helps predict contacts between pairs of residues based on evolutionary coupling. By constructing multiple sequence alignments and computing direct evolutionary couplings between pairs of residues, researchers can identify likely helix-helix interactions that suggest how YidC might interact with substrates .

  • Lipid-versus-protein-exposure prediction: Computational methods can predict which residues are exposed to lipids versus interacting with other proteins, helping to identify potential substrate interaction sites .

  • Site-directed mutagenesis followed by functional assays: Creating specific mutations in YidC residues predicted to interact with substrates and testing their effect on membrane protein insertion provides experimental validation of computational predictions .

  • Cryo-electron microscopy: This technique can capture the structure of YidC bound to the ribosome with a nascent membrane protein substrate, revealing details of the insertion process .

  • Molecular dynamics simulations: These can model how YidC might accommodate and facilitate the insertion of different substrate proteins .

What is the evidence for an evolutionary relationship between YidC and SecY, and how might this inform research on F. tularensis YidC?

There is compelling evidence suggesting that SecY evolved from a dimeric YidC homologue through gene duplication and fusion. This evolutionary model predicts that YidC should retain a tendency to form dimers via the same interface as the SecY progenitor . Supporting this prediction, novel heterodimers formed via this interface have been discovered in archaeal and eukaryotic YidC homologues .

For research on F. tularensis YidC, this evolutionary relationship suggests:

  • Investigation of potential dimerization tendencies of F. tularensis YidC could provide insights into its functional mechanism.

  • Comparative studies with SecY from F. tularensis might reveal conserved functional features.

  • Understanding the evolutionary trajectory could guide the design of inhibitors targeting YidC in pathogenic bacteria.

  • The conservation of specific interfaces might indicate functional importance across bacterial species, including pathogens like F. tularensis.

How can researchers differentiate between YidC-dependent and SecY-dependent membrane protein insertion in F. tularensis?

Researchers can employ several experimental approaches to differentiate between YidC-dependent and SecY-dependent membrane protein insertion:

  • Depletion studies: Systematically depleting YidC or SecY components and assessing the impact on the insertion of various membrane proteins can identify substrate preferences.

  • Crosslinking experiments: Chemical crosslinking of nascent membrane proteins to either YidC or SecY during translation can capture insertion intermediates and identify the primary insertion pathway.

  • In vitro reconstitution: Purifying YidC and SecY components and reconstituting them into liposomes allows testing of insertion efficiency for specific substrate proteins with either system independently.

  • Comparative structural analysis: Understanding the structural differences between how YidC and SecY interact with substrates (YidC inserts at protein-lipid interface; SecY uses a central channel and lateral gate) can guide the design of substrate-specific assays .

  • Mutational analysis: Introducing mutations to disrupt specific pathways can help determine which insertion pathway is used by particular substrates.

What challenges arise when studying YidC's role in F. tularensis compared to model organisms like E. coli?

Several challenges are unique to studying YidC in F. tularensis compared to model organisms:

  • Biosafety concerns: F. tularensis is classified as a Tier 1 Select agent by the CDC due to its potential as a bioterrorism agent, requiring specialized containment facilities for handling live bacteria .

  • Protein expression challenges: Heterologous expression of F. tularensis membrane proteins may encounter folding or stability issues when produced in standard expression systems.

  • Limited genetic tools: Fewer genetic manipulation tools exist for F. tularensis compared to model organisms like E. coli, making functional studies more difficult.

  • Evolutionary divergence: Potential differences in YidC structure or function between F. tularensis and model organisms might complicate the application of known methodologies.

  • Different membrane composition: F. tularensis may have a different lipid membrane composition compared to E. coli, potentially affecting YidC function and substrate specificity.

How can recombinant F. tularensis YidC be used in diagnostic applications?

While YidC itself has not been directly explored as a diagnostic target based on the search results, the approach used for another F. tularensis membrane protein (FopA) could inform similar applications for YidC:

  • Development of antibody-based detection systems: Similar to the approach with FopA, researchers could generate antibodies against F. tularensis YidC for diagnostic purposes. Monoclonal antibodies with high binding affinity and specificity could be developed through hybridoma and phage display technologies .

  • Sandwich ELISA systems: A pair of antibodies recognizing different epitopes on YidC could be used to develop a sandwich ELISA for detecting F. tularensis in various matrices, including clinical and environmental samples .

  • Cross-reactivity assessment: Any diagnostic system would need to be tested against related bacteria to ensure specificity for F. tularensis subsp. novicida YidC.

  • Matrix compatibility testing: Diagnostic systems would need validation across various matrices (PBS, human serum, BSA, environmental samples) to ensure reliable detection in different sample types .

What structural features of YidC could be targeted for antimicrobial development against F. tularensis?

Based on structural and functional studies of YidC, several features could be targeted for antimicrobial development:

  • Key stabilizing residues: Residues that are critical for YidC stability and function, such as those identified in complementation assays (equivalents to T362 in TM2 and Y517 in TM6 in E. coli YidC), could serve as targets for antimicrobial compounds .

  • Ribosome binding interface: The interface where YidC interacts with the ribosome could be targeted to disrupt co-translational membrane protein insertion .

  • Substrate binding site: The region at the protein-lipid interface where substrates are inserted into the membrane represents another potential target .

  • Species-specific regions: Identifying regions that differ between human and bacterial YidC homologues could enable the development of selective antimicrobials.

  • Dimerization interface: If F. tularensis YidC forms functional dimers similar to the proposed evolutionary precursor of SecY, this interface could be a target for disruption .

What are the optimal buffer conditions for maintaining recombinant YidC stability during purification?

Although specific buffer conditions for YidC purification aren't detailed in the search results, general principles for membrane protein purification can be applied:

  • Detergent selection: Choose mild detergents that maintain native protein structure while effectively solubilizing the membrane protein (common options include DDM, LMNG, or digitonin).

  • Buffer components:

    • pH range: Typically 7.0-8.0 to mimic physiological conditions

    • Salt concentration: 150-300 mM NaCl to maintain ionic strength

    • Glycerol (10-15%): To enhance protein stability

    • Reducing agents: Such as DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

    • Protease inhibitors: To prevent degradation during purification

  • Temperature considerations: Maintain samples at 4°C throughout purification to minimize degradation.

  • Stability enhancers: Consider adding specific lipids that might interact with YidC to maintain its native conformation.

For troubleshooting stability issues, researchers could:

  • Test multiple detergent types and concentrations

  • Use thermal shift assays to identify optimal buffer conditions

  • Consider the addition of specific lipids that might stabilize the protein in its native environment

How should researchers design mutation studies to investigate the functional domains of F. tularensis YidC?

When designing mutation studies for F. tularensis YidC, researchers should consider:

  • Evolutionary conservation: Identify highly conserved residues across YidC homologues through multiple sequence alignment. These often represent functionally critical positions .

  • Structural modeling: Use computational approaches like covariation analysis and lipid-versus-protein-exposure prediction to build structural models that can guide mutation selection .

  • Functional domain targeting:

    • Ribosome binding interface: Mutations here could affect co-translational insertion

    • Substrate binding regions: Mutations could alter substrate specificity

    • Transmembrane core stability: Mutations of key stabilizing residues like those identified in E. coli (T362, Y517)

    • Potential dimerization interfaces: Based on evolutionary relationships with SecY

  • Mutation types:

    • Alanine scanning: Systematic replacement with alanine to identify functional residues

    • Conservative vs. non-conservative substitutions: To distinguish between structural and functional roles

    • Domain swapping: With related YidC proteins to identify species-specific functions

  • Functional assays:

    • In vivo complementation assays to test if mutants retain function

    • Protein stability assessments to distinguish between stability and functional defects

    • Substrate insertion assays with model membrane proteins

What controls should be included when assessing YidC-dependent membrane protein insertion?

When assessing YidC-dependent membrane protein insertion, several controls should be included:

  • Positive controls:

    • Known YidC-dependent substrate proteins whose insertion mechanism is well-established

    • Wild-type YidC to establish baseline insertion efficiency

    • Complete membrane protein insertion machinery (including SecY complex) for maximum insertion efficiency

  • Negative controls:

    • YidC-depleted or YidC-knockout conditions

    • Inactive YidC mutants (e.g., equivalents of T362A or Y517A in E. coli)

    • Substrates known to require the SecY complex but not YidC

  • Specificity controls:

    • SecY-dependent but YidC-independent substrates

    • Substrates requiring both SecY and YidC

    • Membrane proteins that insert spontaneously without assistance

  • Technical controls:

    • Membrane integrity verification

    • Protein expression level normalization

    • Verification of YidC protein stability and proper folding

  • Experimental validation approaches:

    • Multiple detection methods for membrane insertion (e.g., protease protection assays, fluorescence-based assays)

    • Verification in both in vitro and in vivo systems when possible

    • Testing across different environmental conditions (pH, temperature, ionic strength)

What are the major unresolved questions regarding F. tularensis YidC function?

Several important questions remain unresolved regarding F. tularensis YidC function:

  • Substrate specificity: What specific membrane proteins in F. tularensis require YidC for insertion, and how does this compare to model organisms?

  • Structural adaptations: How has the structure of YidC in F. tularensis adapted to its specific membrane environment and substrate requirements?

  • Interaction with other machinery: Does F. tularensis YidC interact with the SecY complex in the same manner as in E. coli, or are there species-specific differences?

  • Dimerization tendency: Does F. tularensis YidC form dimers similar to those proposed in the evolutionary model relating YidC to SecY ?

  • Role in pathogenesis: Is YidC function critical for the pathogenicity of F. tularensis, potentially through the insertion of virulence factors?

  • Antimicrobial target potential: Could inhibiting YidC function effectively reduce F. tularensis viability in host environments?

  • Post-translational modifications: Are there specific modifications of YidC in F. tularensis that regulate its function?

  • Environmental adaptation: How does YidC function respond to environmental changes encountered during F. tularensis infection cycles?

How might comparative analysis of YidC across bacterial species inform therapeutic strategies against F. tularensis?

Comparative analysis of YidC across bacterial species could inform therapeutic strategies in several ways:

  • Identification of conserved functional residues: Highly conserved residues that are critical for function across species represent potential broad-spectrum antimicrobial targets .

  • Species-specific variations: Regions that differ between F. tularensis YidC and human YidC homologues could be targeted for selective inhibition.

  • Structural adaptation insights: Understanding how YidC structure varies across species could reveal how this protein adapts to different membrane environments and substrate requirements.

  • Evolution-based drug design: The evolutionary relationship between YidC and SecY suggests that certain interfaces might be conserved for functional reasons and could represent vulnerable targets .

  • Cross-species inhibition patterns: Testing inhibitors against YidC from multiple species could help predict efficacy and resistance mechanisms.

  • Essential substrate pathways: Identifying which membrane proteins absolutely require YidC in F. tularensis compared to other bacteria could reveal pathogen-specific vulnerabilities.

  • Combination therapy approaches: Understanding the interplay between YidC and other membrane protein insertion pathways could suggest combination therapies that target multiple systems simultaneously.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.