Recombinant Francisella tularensis subsp. novicida Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Francisella tularensis subsp. novicida Prolipoprotein Diacylglyceryl Transferase (Lgt) is a genetically engineered enzyme critical for lipoprotein biosynthesis in Gram-negative bacteria. Lgt catalyzes the first step of lipoprotein maturation by transferring a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, forming a thioether bond . This enzyme is essential for bacterial viability and pathogenesis, making it a potential target for antimicrobial therapies .

Research Applications and Findings

Antimicrobial Target Validation

  • Lgt depletion in Escherichia coli and Acinetobacter baumannii disrupts outer membrane integrity, increasing susceptibility to antibiotics and serum killing .

  • Inhibitors targeting Lgt (e.g., compounds G2823 and G2824) show potent bactericidal activity (in vitro IC<sub>50</sub> values: 0.18–0.93 μM) .

Diagnostic and Immunological Use

  • Recombinant Lgt serves as an antigen in ELISA for antibody development and serological studies .

  • Key Performance Metrics:

    ParameterValueSource
    Detection Limit (LoD)0.066–0.074 ng/mL (sandwich ELISA)
    Stability>12 months at -80°C
    Host ReactivityCompatible with murine models

Genetic and Functional Insights

Essentiality in Francisella

  • Transposon mutagenesis studies confirm lgt is essential for F. tularensis survival in vitro, linked to peptidoglycan synthesis and fatty acid metabolism .

  • Deletion of lgt disrupts lipoprotein processing, leading to mislocalization of outer membrane proteins (e.g., Tul4A/B) .

Comparative Analysis

  • Francisella Lgt shares <40% sequence identity with homologs in E. coli or Neisseria, suggesting species-specific adaptations .

  • Structural studies highlight conserved catalytic residues (e.g., cysteine-binding pockets) critical for enzymatic activity .

Future Directions

  • Therapeutic Development: High-throughput screening of Lgt inhibitors for broad-spectrum antibiotics .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve full-length Lgt architecture .

  • Vaccine Design: Exploration of Lgt as a subunit vaccine candidate due to its surface exposure and immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; FTN_1247; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Francisella tularensis subsp. novicida (strain U112)
Target Names
lgt
Target Protein Sequence
MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFY VALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFIGVLIAFALFARKIGAN FFDLGEFVAPVIPIGLGAGRIGNFINGELWGKVTDSPLGMVFPTGGPLPRYPSQLFEFFF EGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGCARFICEFFRQPDPQYGYIFFNWMTMGQI LSIPMILLGAVILIAVFIKTRKNKCENI
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: ftn:FTN_1247

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Francisella tularensis?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in the lipoprotein processing pathway of Francisella tularensis. It catalyzes the first step in lipoprotein maturation by transferring a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This diacylation is essential for proper lipoprotein anchoring to the bacterial membrane. In the context of F. tularensis, lgt functions as part of a modified lipoprotein processing system that differs significantly from the canonical pathways observed in other Gram-negative bacteria like Escherichia coli .

What is known about the genetic organization of the lgt gene in F. tularensis subsp. novicida?

The lgt gene in F. tularensis subsp. novicida exists as part of the organism's core genome rather than within mobile genetic elements. Unlike some virulence factors that might be encoded on pathogenicity islands (such as the Francisella Pathogenicity Island that encodes the Type VI Secretion System components), lgt is part of the essential housekeeping machinery for membrane biogenesis. The gene is chromosomally encoded and appears to be constitutively expressed rather than regulated in response to specific environmental triggers. Comparative genomic analyses across Francisella species show that lgt is highly conserved, reflecting its fundamental role in bacterial physiology rather than being a horizontally acquired trait specific to particular subspecies .

What are the recommended methods for cloning and expressing recombinant F. tularensis lgt?

For cloning and expressing recombinant F. tularensis lgt, the following methodological approach is recommended:

  • Gene amplification: Design primers flanking the full lgt coding sequence with appropriate restriction sites. Include a 6×His tag at either the N-terminus (if signal peptide is absent) or C-terminus for purification.

  • Vector selection: Choose expression vectors with tunable promoters (like pET systems) to control expression levels, as membrane proteins can be toxic when overexpressed.

  • Expression host: Use E. coli strains specialized for membrane protein expression (C41/C43) or those lacking endogenous lgt to prevent interference.

  • Expression conditions: Induce at lower temperatures (16-20°C) with reduced inducer concentrations to improve proper folding of membrane proteins.

  • Membrane isolation protocol: After cell lysis, separate membrane fractions through ultracentrifugation at 100,000 × g for 1 hour.

  • Protein solubilization: Extract the membrane-bound lgt using mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration.

This approach accounts for the challenges of expressing membrane-associated enzymes while preserving their structural integrity and enzymatic activity .

What assays can be used to confirm the enzymatic activity of recombinant lgt?

To confirm the enzymatic activity of recombinant lgt, researchers can employ several complementary assays:

  • In vitro diacylation assay: Incubate purified recombinant lgt with synthetic prolipopeptide substrates and radiolabeled phosphatidylglycerol. Detect transfer of the diacylglyceryl moiety through thin-layer chromatography or mass spectrometry.

  • Complementation assay: Transform an lgt-deficient bacterial strain with the recombinant lgt construct and assess restoration of lipoprotein processing through Western blotting of known lipoproteins.

  • Fluorescence-based assay: Use fluorescent phospholipid analogs and FRET-based detection to monitor real-time lipid transfer activity.

  • Metabolic labeling: Incubate bacteria expressing recombinant lgt with radiolabeled fatty acids and immunoprecipitate known lipoprotein substrates to assess incorporation.

The combination of these approaches provides robust validation of enzymatic function, with the complementation assay being particularly valuable as it demonstrates activity in a cellular context rather than only with purified components .

How can researchers generate lgt knockout mutants in F. tularensis subsp. novicida?

Generating lgt knockout mutants in F. tularensis subsp. novicida requires specialized approaches due to the organism's pathogenicity and genetic manipulation challenges:

  • Allelic exchange method:

    • Design flanking homology regions (~1 kb each) surrounding the lgt gene

    • Clone these regions into a suicide vector (e.g., pMP590) flanking an antibiotic resistance marker

    • Introduce the construct via electroporation (25 µF, 2.5 kV, 600 Ω)

    • Select for single recombinants on selective media

    • Counter-select with sucrose (8-10%) to identify double recombinants that have lost the plasmid backbone

  • TargeTron system adaptation:

    • Design group II intron retargeting constructs specific to lgt sequence

    • Express the retargeting construct from a temperature-sensitive plasmid

    • Induce intron insertion and select for disruption events

  • Verification approaches:

    • PCR verification of proper insertion/deletion

    • RT-PCR to confirm absence of lgt transcript

    • Western blotting to verify disrupted lipoprotein processing

    • Phenotypic assays demonstrating expected changes in membrane integrity

Given that lgt is likely essential for F. tularensis viability, constructing conditional knockouts using inducible promoters may be necessary to study the gene's function while maintaining bacterial viability under permissive conditions .

How does lgt contribute to F. tularensis pathogenesis and host immune evasion?

Lgt plays a critical role in F. tularensis pathogenesis through its essential function in processing outer membrane lipoproteins that interface with host immunity:

  • Virulence factor maturation: Lgt is required for the proper processing of several virulence-associated lipoproteins, including Tul4A (LpnA) and Tul4B (LpnB), which are known TLR2 agonists that modulate host immune responses . When properly processed by Lgt, these lipoproteins adopt conformations that can either activate or suppress TLR2 signaling depending on their presentation context.

  • Immune evasion: The diacylated lipoproteins in F. tularensis (lacking the third acyl chain typically added by Lnt) demonstrate altered immunostimulatory properties compared to the triacylated lipoproteins of most Gram-negative bacteria. This modification helps F. tularensis evade TLR2/TLR1-mediated recognition, as this receptor complex preferentially recognizes triacylated lipopeptides .

  • Intracellular survival: Proper processing of lipoproteins by Lgt is essential for F. tularensis to escape from the phagosome and replicate in the cytosol of macrophages. This is evidenced by the role of properly processed lipoproteins in modulating phagosomal maturation and facilitating membrane disruption .

  • Interference with IFNγ signaling: F. tularensis actively suppresses IFNγ-induced STAT1 expression and phosphorylation in mononuclear phagocytes. The properly processed lipoproteins contribute to this immune evasion strategy by driving the expression of SOCS3, a negative regulator of IFNγ signaling .

These multifaceted roles make lgt a critical contributor to the remarkable infectivity of F. tularensis, which can establish infection with as few as 5-10 organisms via the respiratory route .

What is the relationship between lgt and the other lipoprotein processing enzymes (lsp and lnt) in F. tularensis?

The relationship between the lipoprotein processing enzymes in F. tularensis represents a unique variation from the canonical pathway observed in other Gram-negative bacteria:

Processing StepEnzymeFunctionEssential in F. tularensisEssential in E. coli
1LgtDiacylglycerol transferLikely yesYes
2LspSignal peptide cleavageYesYes
3LntN-acylation (third acyl chain)NoYes

The distinctive feature of F. tularensis is that the lnt gene, unlike in most Gram-negative bacteria, is not essential for viability or proper lipoprotein sorting . This creates a sequential dependency where:

  • Lgt action must precede Lsp processing, as the signal peptidase specifically recognizes diacylated substrates.

  • Lsp processing must occur for proper lipoprotein sorting.

  • Lnt action is dispensable in F. tularensis but essential in most other Gram-negative bacteria.

This relationship is functionally significant because it indicates that F. tularensis has evolved a modified Lol (lipoprotein outer membrane localization) sorting system that can recognize and process diacylated lipoproteins without requiring the final N-acylation step . This feature represents an evolutionary divergence that may contribute to the unique pathogenic properties of Francisella species.

How do mutations in lgt affect the structure and function of the F. tularensis outer membrane?

Mutations in lgt significantly impact the structure and function of the F. tularensis outer membrane through several mechanisms:

  • Lipoprotein anchoring disruption: Loss of lgt function prevents the diacylation of prolipoproteins, resulting in improperly anchored lipoproteins that fail to integrate correctly into the membrane. This leads to lipoprotein shedding and compromised membrane integrity.

  • Altered membrane permeability: Studies on lgt mutants in related bacteria show increased susceptibility to hydrophobic antibiotics (like rifampin) and membrane-disrupting agents, suggesting that lgt mutations create a more permeable outer membrane with compromised barrier function .

  • Dysregulated protein sorting: Without proper diacylation, the Lol sorting system cannot efficiently differentiate between outer membrane and inner membrane-destined lipoproteins, leading to mislocalization of critical membrane components.

  • Stress response activation: Improper lipoprotein processing activates envelope stress responses, including upregulation of periplasmic chaperones and alternative sigma factors that alter the expression of numerous membrane-associated proteins.

  • Reduced virulence factor expression: Mutations in lgt affect the proper processing of virulence-associated lipoproteins, including those encoded by the Francisella Pathogenicity Island (FPI), which are essential for intracellular survival and virulence .

These structural and functional alterations explain why lgt is likely essential in F. tularensis, as is the case in most bacteria, despite the unusual non-essentiality of the downstream processing enzyme Lnt in this species .

How conserved is lgt across Francisella species and subspecies?

Prolipoprotein diacylglyceryl transferase (lgt) demonstrates high conservation across Francisella species and subspecies, reflecting its fundamental role in bacterial physiology:

  • Sequence homology: Comparative genomic analyses reveal >90% amino acid sequence identity for lgt across F. tularensis subspecies (tularensis, holarctica, mediasiatica) and >85% identity when compared with F. novicida. This high conservation contrasts with the greater genomic divergence observed in other metabolic enzymes.

  • Functional domains: The catalytic domain containing the essential amino acid residues for diacylglyceryl transfer is nearly identical across all Francisella species, indicating strong selective pressure to maintain enzymatic function.

  • Genetic context: The genomic neighborhood surrounding lgt is generally conserved across Francisella species, suggesting the gene has been vertically inherited rather than acquired through lateral gene transfer events that have shaped other aspects of Francisella evolution .

  • Expression patterns: Transcriptomic studies indicate similar constitutive expression patterns of lgt across different Francisella subspecies, further supporting its conserved housekeeping role.

This high degree of conservation makes lgt a potential target for developing broad-spectrum therapeutics or diagnostic tools applicable across the entire Francisella genus .

What functional differences exist between F. tularensis lgt and its homologs in other bacterial pathogens?

While lgt proteins share core functional similarities across bacterial species, F. tularensis lgt exhibits several distinctive characteristics compared to its homologs in other pathogens:

  • Substrate specificity: F. tularensis lgt demonstrates broader substrate tolerance, processing prolipoproteins with atypical lipobox sequences that would not be recognized by lgt homologs in organisms like E. coli or Pseudomonas aeruginosa.

  • Cofactor requirements: Unlike some lgt homologs that require specific phospholipid compositions for optimal activity, F. tularensis lgt maintains functionality across a wider range of membrane environments, possibly reflecting adaptation to the various host cells it inhabits during infection.

  • Regulatory context: While lgt expression in many bacteria is coordinated with other membrane biogenesis pathways, F. tularensis lgt appears to operate more independently, with less integration into traditional envelope stress responses.

  • Structural features: Molecular modeling suggests F. tularensis lgt contains unique surface loops that may facilitate interaction with the distinctive outer membrane composition of this organism, which contains unusual phospholipids and lipid A structures.

  • Interaction with sorting systems: F. tularensis lgt functions within a modified lipoprotein sorting system that, unlike most Gram-negative bacteria, can process diacylated (rather than exclusively triacylated) lipoproteins through the Lol pathway to the outer membrane .

These functional differences likely contribute to the unique aspects of F. tularensis pathogenesis, including its remarkable ability to invade host cells and evade immune detection .

What role might lateral gene transfer have played in the evolution of lipoprotein processing in Francisella?

While lateral gene transfer (LGT) has significantly influenced bacterial evolution and particularly virulence traits, its contribution to lipoprotein processing in Francisella appears minimal compared to vertical inheritance and adaptive evolution:

  • Core genome components: The lipoprotein processing genes (lgt, lsp, lnt) in Francisella show phylogenetic distributions consistent with vertical inheritance rather than horizontal acquisition. They lack hallmarks of LGT such as aberrant GC content, codon usage bias, or flanking mobile genetic elements .

  • Adaptive modifications: The unique characteristics of the Francisella lipoprotein processing system (particularly the non-essentiality of lnt) appear to result from gradual adaptive modifications rather than wholesale gene acquisition events. This is evidenced by the presence of a functional but non-essential lnt gene, suggesting evolutionary modification of an ancestral system rather than recent acquisition .

  • Regulatory integration: Unlike many laterally transferred genes that show distinct regulatory patterns, the lipoprotein processing genes in Francisella display regulatory integration with core metabolic processes, further supporting their ancient presence in the genome.

  • Selective advantages: The modified lipoprotein processing system in Francisella confers selective advantages in host-pathogen interactions by altering the immunostimulatory properties of bacterial lipoproteins. This represents adaptation of existing machinery rather than acquisition of novel virulence factors .

While LGT has contributed substantially to other aspects of Francisella virulence (particularly genes within the Francisella Pathogenicity Island), the core lipoprotein processing machinery appears to have evolved primarily through selective pressures acting on vertically inherited genes .

What are promising approaches for targeting lgt for antimicrobial development against F. tularensis?

Several promising approaches for targeting lgt as an antimicrobial strategy against F. tularensis warrant investigation:

  • Structure-based inhibitor design: With advances in structural biology techniques, obtaining crystal structures of F. tularensis lgt would enable rational design of small molecule inhibitors that could block the enzyme's active site. Computational approaches like molecular docking can accelerate the identification of lead compounds targeting specific catalytic residues.

  • Transition-state analogs: Designing stable compounds that mimic the transition state of the diacylglyceryl transfer reaction could yield potent competitive inhibitors with high specificity for bacterial lgt enzymes while sparing host cell processes.

  • Allosteric inhibitors: Targeting non-catalytic regulatory sites on lgt could disrupt enzyme function while potentially overcoming resistance mechanisms that might emerge against active-site inhibitors.

  • Peptidomimetic approaches: Developing non-hydrolyzable peptide analogs of the lipobox sequence could competitively inhibit lgt activity by preventing substrate binding.

  • Combination therapies: Given F. tularensis's low infectious dose (5-10 organisms via respiratory route) and high mortality rate (up to 35% for pulmonary infection with type A strains), combining lgt inhibitors with existing antibiotics could enhance efficacy and reduce emergence of resistance .

The target validation for these approaches is strengthened by the likely essentiality of lgt in F. tularensis and its absence in mammalian cells, offering a potentially wide therapeutic window for lgt-targeted antimicrobials .

How can advanced imaging techniques enhance our understanding of lgt localization and dynamics?

Advanced imaging techniques offer unprecedented opportunities to elucidate the subcellular localization, dynamics, and interactions of lgt in F. tularensis:

  • Super-resolution microscopy: Techniques like PALM (Photoactivated Localization Microscopy) and STORM (Stochastic Optical Reconstruction Microscopy) can resolve lgt localization at nanometer precision, revealing potential membrane microdomains where lipoprotein processing occurs. This could be achieved by tagging lgt with photoactivatable fluorescent proteins while maintaining its native expression levels.

  • Single-molecule tracking: Using quantum dots or photoactivatable fluorophores conjugated to lgt can enable tracking of individual enzyme molecules in living bacteria, providing insights into diffusion rates, confinement zones, and potential interaction with other processing enzymes.

  • FRET-based interaction studies: Förster Resonance Energy Transfer techniques could reveal the spatial and temporal dynamics of lgt interactions with substrate prolipoproteins and other components of the lipoprotein processing machinery, including potential substrate channeling between lgt and lsp.

  • Correlative light-electron microscopy (CLEM): This approach could connect the fluorescence visualization of lgt with ultrastructural features of the bacterial membrane, providing context for how lgt localization relates to membrane architecture.

  • Cryo-electron tomography: Applied to F. tularensis expressing tagged lgt, this technique could visualize the three-dimensional arrangement of lipoprotein processing complexes in situ at molecular resolution.

These advanced imaging approaches would significantly enhance our understanding of how spatial organization influences the efficiency and regulation of lipoprotein processing in F. tularensis, potentially revealing new targetable vulnerabilities .

What is the potential role of lgt in developing attenuated live vaccine strains of F. tularensis?

The strategic modification of lgt presents intriguing possibilities for developing attenuated live vaccine strains of F. tularensis:

  • Conditional attenuation strategies: Engineering temperature-sensitive lgt mutants could create strains that grow normally at lower temperatures (for vaccine production) but become attenuated at human body temperature, allowing limited replication that induces robust immunity without causing disease.

  • Partial function mutants: Creating point mutations in lgt that reduce but don't eliminate enzymatic activity could generate strains with compromised outer membrane integrity and reduced virulence while maintaining sufficient viability to serve as live vaccines.

  • Regulatable expression systems: Placing lgt under the control of inducible promoters could allow for controlled attenuation after initial host colonization, balancing the need for immunogenicity with safety.

  • Heterologous complementation: Replacing native F. tularensis lgt with orthologs from less virulent bacteria could create chimeric strains with altered lipoprotein processing that reduces pathogenicity while preserving antigenic presentation.

  • Lgt as an antigen carrier: Modified lgt could serve as a carrier to present heterologous antigens to the immune system, leveraging its membrane localization to enhance vaccine efficacy.

Preliminary evidence supporting these approaches comes from studies showing that even subtle alterations in membrane structure through lipoprotein processing modifications can dramatically reduce virulence while preserving immunogenicity. The unique aspects of F. tularensis lipoprotein processing, particularly the non-essentiality of lnt, suggest that fine-tuning this pathway could yield vaccine strains with optimal safety and efficacy profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.