Recombinant Francisella tularensis subsp. tularensis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Comparative Analysis of Recombinant atpF Variants:

FeatureRecombinant atpF (His-tagged) Native atpF (Wild-Type)
Expression HostE. coliF. tularensis
Molecular Weight~18 kDa~17.5 kDa
Catalytic ActivityRetains ATP hydrolysis functionNative enzymatic activity
StabilityStable in Tris buffer + 50% glycerol Labile under standard conditions

Functional Role in Bacterial Physiology

ATP synthase is essential for energy metabolism in F. tularensis, enabling survival in nutrient-limited intracellular environments . The subunit b (atpF) anchors the F0 sector to the F1 catalytic domain, forming a proton channel critical for ATP synthesis .

Experimental Findings:

  • Gene Essentiality: Knockout mutants of atpF exhibit impaired growth in macrophages, confirming its role in intracellular survival .

  • Metabolic Dependency: F. tularensis relies on ATP synthase for glycerol and fatty acid utilization during infection, as shown via AMPK activation studies .

Production and Purification Protocols

Recombinant atpF is synthesized using plasmid vectors (e.g., pET-based systems) in E. coli BL21 strains .

Key Steps:

  1. Cloning: atpF gene inserted into an E. coli shuttle vector with a T7 promoter.

  2. Induction: Expression triggered by IPTG at mid-log phase.

  3. Purification: Ni-NTA affinity chromatography under denaturing/native conditions .

  4. Storage: Stabilized in Tris-based buffer (pH 8.0) with 50% glycerol at -80°C .

Vaccine Development

atpF is investigated as a subunit vaccine candidate due to its surface exposure and immunogenicity . Studies show antibodies against atpF reduce bacterial load in murine models .

Drug Target Exploration

ATP synthase inhibitors (e.g., bedaquiline analogs) disrupt F. tularensis energy metabolism, with recombinant atpF used for high-throughput inhibitor screening .

Pathogenesis Studies

  • Virulence Linkage: Deletion of tolC, a multidrug efflux pump, attenuates F. tularensis virulence, highlighting the interplay between energy metabolism and antibiotic resistance .

  • Intracellular Replication: atpF supports bacterial proliferation in macrophages by maintaining proton motive force .

Challenges and Future Directions

  • Thermostability: Recombinant atpF shows reduced activity above 37°C, limiting in vivo applications .

  • Structural Studies: Cryo-EM of ATP synthase complexes could elucidate atpF’s role in proton translocation .

  • Therapeutic Potential: Fusion proteins combining atpF with other antigens (e.g., FopA) may enhance vaccine efficacy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpF; FTW_0136; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain WY96-3418)
Target Names
atpF
Target Protein Sequence
MDINITLIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIIENAYVRAHKVDEQAKEEAIAAADKIKSMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFVEKV
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) to F(0).
Database Links

KEGG: ftw:FTW_0136

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of ATP synthase subunit b in Francisella tularensis?

The ATP synthase subunit b in F. tularensis, like in other bacteria, functions as part of the peripheral stalk of F₁F₀ ATP synthase. The structure consists of a membrane-spanning domain and a soluble part. The soluble part is further divided into three distinct functional domains: the tether domain, dimerization domain, and δ-binding domain . Nuclear magnetic resonance (NMR) studies have revealed that the tether domain (b30-82) exists primarily as an α-helix in solution, with the α-helical structure extending from residues 39 to 72 . The total length of the b30-82 fragment is approximately 48.07 Å . When the structures of various domains (b1-33, b30-82, b62-122, and b140-156) are combined, they form a single unbroken curved α-helix, with the exception of residues 35-38 which have not been structurally defined .

How does the structural organization of ATP synthase subunit b contribute to its function?

The ATP synthase subunit b serves as a relatively inflexible peripheral stalk within the F₁F₀ ATP synthase complex. This structural characteristic is similar to the subunit b of mitochondrial F₁F₀ ATP synthase . The surface charge distribution of b30-82 shows a distinctive pattern with one side displaying a hydrophobic surface formed by alanine residues . This organization is crucial for the proper assembly and function of the ATP synthase complex.

The specific positioning of residues in the α-helices facilitates disulfide bond formation at certain positions (61, 68, and 72) but not at others (such as position 70), indicating a precise spatial arrangement of the helices . This structured arrangement supports the mechanical role of subunit b in energy transduction during ATP synthesis.

DomainResiduesStructureFunction
Membrane-spanning~1-29Transmembrane α-helixAnchors to F₀ sector
Tether~30-82α-helix (residues 39-72)Connects membrane domain to dimerization domain
Dimerization~62-122α-helixForms dimer with second b subunit
δ-binding~140-156α-helixInteracts with δ subunit of F₁ sector

What are the optimal expression systems for producing recombinant F. tularensis ATP synthase subunit b?

For the recombinant production of F. tularensis ATP synthase subunit b, an E. coli-based expression system has proven effective. When designing an expression construct, considerations should include:

  • Use of a strong inducible promoter (such as T7)

  • Inclusion of appropriate affinity tags (His-tag) for purification

  • Optimization of codon usage for E. coli expression

  • Selection of expression strains that can handle potentially toxic proteins

Based on research with F. tularensis proteins, expression at lower temperatures (16-25°C) after induction may improve solubility and proper folding . For structural studies, isotope labeling (¹⁵N and ¹³C) can be incorporated by growing expression cultures in minimal media with labeled nitrogen and carbon sources .

What purification strategy yields the highest purity recombinant F. tularensis ATP synthase subunit b?

A multi-step purification protocol is recommended:

  • Initial capture via affinity chromatography (Ni-NTA for His-tagged constructs)

  • Ion exchange chromatography to remove contaminating proteins

  • Size exclusion chromatography for final polishing and buffer exchange

For structural studies of specific domains, such as the tether domain (b30-82), additional considerations include:

  • Expression of domain-specific constructs rather than the full-length protein

  • Buffer optimization to maintain protein stability and prevent aggregation

  • Verification of proper folding using circular dichroism spectroscopy

This approach has been successful in generating milligram quantities of properly folded protein suitable for structural and biochemical studies .

How can site-directed mutagenesis be effectively used to study F. tularensis ATP synthase subunit b function?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in ATP synthase subunit b. Based on established methodologies:

  • Key alanine residues (61, 68, 70, and 72) can be replaced with cysteines to study potential disulfide bond formation and structural organization

  • Mutations in the dimerization domain affect enzyme assembly and function, indicating critical regions for proper function

  • The tether domain shows more tolerance to deletions and extensions without disrupting assembly or function, suggesting a more flexible role

When designing mutagenesis experiments:

  • Select residues based on structural information and sequence conservation

  • Use complementary biochemical assays to assess the impact on ATP synthase assembly and activity

  • Consider both conservative and non-conservative substitutions to probe functional importance

Crosslinking studies with cysteine mutants can provide valuable information about the spatial arrangement of subunits within the ATP synthase complex .

What biophysical techniques are most informative for characterizing recombinant F. tularensis ATP synthase subunit b?

Several complementary biophysical techniques provide valuable insights:

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Provides detailed atomic-level structural information in solution

    • Has been successfully used to determine the structure of the b30-82 fragment

    • Enables analysis of protein dynamics and flexibility

  • Circular Dichroism (CD) Spectroscopy:

    • Confirms secondary structure composition (α-helical content)

    • Monitors thermal stability and structural changes

    • Useful for rapid assessment of properly folded protein

  • X-ray Crystallography:

    • Provides high-resolution structural information

    • Has been used for the b62-122 fragment

    • Complementary to NMR data for comprehensive structural analysis

  • Crosslinking Studies:

    • Probes spatial relationships between residues

    • Can utilize engineered cysteine residues to form disulfide bonds

    • Provides constraints for structural modeling

The combination of these techniques has revealed that E. coli subunit b forms a single unbroken curved α-helix (excluding residues 35-38) , which likely serves as a model for understanding F. tularensis ATP synthase subunit b.

How does ATP synthase function contribute to F. tularensis virulence and intracellular survival?

F. tularensis is a facultative intracellular pathogen that must adapt to different environments during infection . While the direct role of ATP synthase in virulence is not fully characterized, several factors suggest its importance:

  • Intracellular Energy Metabolism:

    • ATP production is essential for bacterial survival within host cells

    • F. tularensis can replicate within macrophages, requiring energy generation systems

    • The bacterium must adapt to nutrient-limited conditions inside host cells

  • Potential pH Regulation:

    • ATP synthase can function in reverse to maintain intracellular pH

    • This may contribute to survival in acidified phagosomes

  • Interaction with Host Cell Components:

    • Surface-exposed proteins, including ATP synthase components, may interact with host factors

    • These interactions could influence host-pathogen recognition and immune responses

The ability of F. tularensis to evade host defenses, particularly by inhibiting the respiratory burst in neutrophils , may be indirectly supported by energy-dependent processes requiring ATP synthase function.

Could ATP synthase subunit b represent a potential therapeutic target against F. tularensis?

ATP synthase could be considered as a potential therapeutic target based on several considerations:

  • Essential Function:

    • ATP synthesis is critical for bacterial viability

    • Disruption of energy metabolism would affect multiple virulence mechanisms

  • Structural Uniqueness:

    • Differences between bacterial and human ATP synthases could allow selective targeting

    • The peripheral stalk region containing subunit b has distinct features in bacteria

  • Surface Accessibility:

    • Components of ATP synthase may be accessible to antibodies or small molecules

    • Inhibitors that disrupt assembly or function could have antimicrobial effects

  • Challenges:

    • Highly conserved nature of ATP synthase across bacteria

    • Potential for off-target effects on human mitochondrial ATP synthase

    • Need for penetration into intracellular compartments

Any therapeutic approach would require careful design to achieve selectivity and efficacy against intracellular bacteria. Structural information about F. tularensis ATP synthase subunit b provides a foundation for rational drug design efforts.

What proteomic approaches can identify post-translational modifications of ATP synthase subunit b in F. tularensis?

Advanced proteomic techniques for investigating post-translational modifications include:

  • Mass Spectrometry-Based Approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive PTM mapping

    • Targeted selected reaction monitoring (SRM) for quantification of specific modifications

    • Electron transfer dissociation (ETD) for preserving labile modifications during analysis

  • Enrichment Strategies:

    • Phosphopeptide enrichment using titanium dioxide or immobilized metal affinity chromatography

    • Antibody-based enrichment for specific modifications (acetylation, methylation)

    • Chemical tagging approaches for capturing specific PTMs

Comparative proteomics between virulent and attenuated F. tularensis strains has identified differences in protein expression profiles , suggesting that PTM analysis could reveal additional regulatory mechanisms affecting virulence.

PTM TypeEnrichment MethodMS FragmentationBiological Significance
PhosphorylationTiO₂, IMACHCD, ETDEnergy regulation, signaling
AcetylationAnti-acetyl lysine antibodiesHCDProtein stability, interaction
MethylationAnti-methyl antibodiesHCDProtein function regulation
GlycosylationLectin affinityETDSurface recognition, stability

What computational approaches are valuable for predicting interactions between ATP synthase subunit b and other bacterial proteins?

Several computational methods can help predict and analyze protein-protein interactions:

  • Homology-Based Structural Modeling:

    • Using solved structures of ATP synthase components from other bacteria as templates

    • Mapping sequence conservation onto structural models to identify interaction interfaces

    • Predicting the impact of mutations on complex stability

  • Molecular Dynamics Simulations:

    • Analyzing conformational dynamics of ATP synthase subunit b

    • Investigating the stability of protein-protein interfaces

    • Predicting the effects of environmental conditions on complex integrity

  • Protein-Protein Docking:

    • Predicting interaction modes between subunit b and other ATP synthase components

    • Evaluating binding energies and interface characteristics

    • Generating testable hypotheses for experimental validation

  • Network Analysis:

    • Integrating proteomic data to construct interaction networks

    • Identifying hub proteins and essential interactions

    • Comparing interaction networks across different bacterial species

These computational approaches can guide experimental design and help interpret results from structural and functional studies of F. tularensis ATP synthase.

What are the key considerations when designing experiments to study ATP synthase activity in F. tularensis?

When investigating ATP synthase activity in F. tularensis, several experimental considerations are critical:

  • Biosafety Requirements:

    • F. tularensis is classified as a Tier 1 Select Agent requiring BSL-3 containment

    • Consider using attenuated strains such as the Live Vaccine Strain (LVS) for initial studies

    • Ensure compliance with all regulatory requirements for Select Agent research

  • Membrane Protein Challenges:

    • ATP synthase is a membrane-embedded complex requiring appropriate detergents for extraction

    • Native-like lipid environments are important for maintaining function

    • Consider nanodiscs or other membrane mimetics for functional studies

  • Activity Assays:

    • ATP synthesis can be measured using luciferase-based luminescence assays

    • ATP hydrolysis can be monitored via phosphate release assays

    • Proton translocation can be assessed using pH-sensitive fluorescent dyes

    • Experiments should include appropriate controls (inhibitors such as oligomycin)

  • Genetic Manipulation:

    • Creating gene knockouts or conditional mutants of ATP synthase components

    • Complementation studies to verify phenotypes

    • Site-directed mutagenesis to study specific residues

Collaborations between structural biologists, biochemists, and microbiologists can provide comprehensive insights into ATP synthase function in this pathogen.

How can researchers effectively study the assembly of ATP synthase complexes in F. tularensis?

Studying ATP synthase assembly requires specialized techniques:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Separates intact membrane protein complexes

    • Can visualize assembly intermediates and subcomplexes

    • Western blotting with subunit-specific antibodies identifies complex composition

  • Protein-Protein Crosslinking:

    • Chemical crosslinkers with varying spacer lengths capture transient interactions

    • Mass spectrometry analysis identifies crosslinked peptides and interaction sites

    • In vivo crosslinking provides physiologically relevant information

  • Fluorescence Microscopy Approaches:

    • Protein fusions with fluorescent proteins to monitor localization

    • Fluorescence resonance energy transfer (FRET) to assess protein proximity

    • Super-resolution microscopy for detailed spatial organization

  • Co-immunoprecipitation:

    • Pull-down assays with antibodies against specific subunits

    • Identification of interaction partners by mass spectrometry

    • Can detect both stable and transient interactions

Understanding ATP synthase assembly in F. tularensis could reveal pathogen-specific features that might be exploited for therapeutic intervention.

How does F. tularensis ATP synthase subunit b compare with that of other pathogenic bacteria?

Comparative analysis reveals both conserved features and differences:

A table comparing key features across selected bacterial pathogens:

SpeciesLength (aa)Key Structural FeaturesNotable Adaptations
F. tularensis~156Extended α-helix, distinct hydrophobic surfaceAdaptations for intracellular survival
E. coli156Well-characterized α-helical structureModel system for ATP synthase studies
M. tuberculosis~164Additional C-terminal regionAdapted for long-term persistence
Y. pestis~150Similar domain organizationPotential roles in stress response

Understanding these comparisons provides context for F. tularensis-specific features that may relate to its unique pathogenic lifestyle.

What lessons from E. coli ATP synthase research can be applied to studying F. tularensis ATP synthase?

E. coli serves as a valuable model system with transferable approaches:

  • Structural Methodologies:

    • The successful structural characterization of E. coli subunit b domains provides templates for F. tularensis studies

    • Similar expression constructs and purification strategies can be employed

    • Combining NMR and crystallographic approaches for comprehensive structural analysis

  • Functional Assays:

    • Well-established assays for ATP synthesis and hydrolysis

    • Proton translocation measurement techniques

    • Reconstitution systems for functional studies

  • Mutagenesis Strategies:

    • Targeting conserved residues identified in E. coli studies

    • Structure-guided design of mutations to test specific hypotheses

    • Complementation approaches to verify function

  • Complex Assembly Analysis:

    • Protocols for isolation of intact ATP synthase complexes

    • Characterization of assembly intermediates

    • Investigation of subunit stoichiometry

The extensive research on E. coli ATP synthase subunit b structure, particularly the findings that it forms a single unbroken curved α-helix , provides a foundation for understanding the corresponding protein in F. tularensis.

What are the most promising avenues for future research on F. tularensis ATP synthase subunit b?

Several high-priority research directions would advance understanding of this protein:

  • Comprehensive Structural Analysis:

    • Complete structure determination of full-length F. tularensis ATP synthase subunit b

    • Cryo-electron microscopy of the entire ATP synthase complex

    • Dynamics studies to understand conformational changes during function

  • Host-Pathogen Interactions:

    • Investigation of potential interactions between ATP synthase components and host proteins

    • Role in immune recognition and evasion

    • Contribution to intracellular adaptation

  • Regulatory Mechanisms:

    • Identification of post-translational modifications affecting function

    • Transcriptional and translational regulation under different conditions

    • Response to environmental stresses encountered during infection

  • Therapeutic Targeting:

    • Design of specific inhibitors based on structural information

    • Antibody-based approaches targeting accessible epitopes

    • Evaluation of effects on bacterial viability and virulence

These directions would build on current knowledge and potentially lead to new strategies for combating F. tularensis infections.

What technological advances would most benefit research on F. tularensis ATP synthase?

Several emerging technologies could significantly advance this research area:

  • Cryo-Electron Tomography:

    • Visualization of ATP synthase in its native cellular context

    • Insights into spatial organization and interactions with other complexes

    • Structural information under physiologically relevant conditions

  • Single-Molecule Techniques:

    • Fluorescence microscopy to observe individual complexes

    • Optical tweezers to measure mechanical properties and forces

    • Direct observation of rotational dynamics

  • Advanced Mass Spectrometry:

    • Top-down proteomics for intact protein analysis

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

    • Crosslinking mass spectrometry for interaction mapping

  • Genome Editing Technologies:

    • CRISPR-based approaches for precise genetic manipulation

    • Creation of conditional mutants to study essential components

    • In situ tagging for visualization and purification

These technological advances would provide unprecedented insights into the structure, function, and biology of F. tularensis ATP synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.