Recombinant Francisella tularensis subsp. tularensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Francisella tularensis and plsY

Francisella tularensis is one of the most virulent pathogenic bacteria known, causing the acute human respiratory disease tularemia . The bacterium is a gram-negative facultative intracellular pathogen that can disseminate throughout infected hosts, causing potentially life-threatening infections . Despite its clinical significance, many of the mechanisms underlying F. tularensis pathogenesis remain largely unknown .

Glycerol-3-phosphate acyltransferase (plsY) represents a critical enzyme in bacterial phospholipid biosynthesis. This enzyme, encoded by the plsY gene, catalyzes the transfer of an acyl group to glycerol-3-phosphate, forming lysophosphatidic acid, a precursor in membrane phospholipid synthesis . The official enzyme classification (EC) designation positions it within the family of acyltransferases .

Molecular Properties

The recombinant plsY protein from Francisella tularensis subsp. tularensis is available as a full-length protein comprising 204 amino acids (positions 1-204) . The commercially available recombinant form typically includes an N-terminal His-tag to facilitate purification and detection in research applications . The protein is derived from the Francisella tularensis strain SCHU S4/Schu 4, which is significant in research contexts due to its high virulence .

The product specifications of commercially available recombinant plsY are summarized in Table 1:

CharacteristicSpecification
Source organismFrancisella tularensis subsp. tularensis
Expression systemE. coli
Protein lengthFull length (1-204 amino acids)
TagN-terminal His-tag
UniProt IDQ5NFU6
FormLyophilized powder
Purity>90% (SDS-PAGE verified)

Functional Properties of plsY

Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in bacterial phospholipid biosynthesis. The enzyme functions by catalyzing the acylation of glycerol-3-phosphate at the sn-1 position using acyl phosphate as the acyl donor, resulting in the formation of 1-acyl-glycerol-3-phosphate (lysophosphatidic acid) . This reaction represents a critical step in the biosynthesis of bacterial membrane phospholipids.

The plsY protein is also known by several alternative names that reflect its enzymatic function, including:

  • Acyl-PO4 G3P acyltransferase

  • Acyl-phosphate--glycerol-3-phosphate acyltransferase

  • G3P acyltransferase (GPAT)

  • Lysophosphatidic acid synthase (LPA synthase)

While the specific role of plsY in F. tularensis virulence has not been directly characterized in the available search results, the importance of membrane integrity and phospholipid composition in bacterial pathogenesis is well established. In many bacterial pathogens, enzymes involved in membrane biosynthesis are critical for survival within host cells and resistance to host defense mechanisms.

Production and Purification Methods

The recombinant Francisella tularensis subsp. tularensis plsY protein is typically produced using bacterial expression systems, specifically Escherichia coli . This heterologous expression approach allows for the efficient production of significant quantities of the protein for research applications.

The production process generally involves the following steps:

  1. Cloning of the plsY gene from F. tularensis subsp. tularensis (strain SCHU S4/Schu 4)

  2. Insertion into an appropriate expression vector with an N-terminal His-tag

  3. Transformation of E. coli with the expression construct

  4. Induction of protein expression in bacterial culture

  5. Cell harvesting and lysis

  6. Protein purification via affinity chromatography, utilizing the His-tag

  7. Further purification steps as needed to achieve >90% purity

  8. Quality control assessment via SDS-PAGE

The purified protein is typically provided in a lyophilized powder form, which enhances stability during storage and transportation .

Reconstitution Protocol

The recommended reconstitution protocol involves the following steps:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation for long-term storage)

  4. Aliquot the reconstituted protein to minimize freeze-thaw cycles

  5. Store at -20°C or -80°C for long-term use

The reconstituted protein is typically buffered in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose to enhance stability .

Research Applications

The recombinant plsY protein from Francisella tularensis has several potential research applications, including:

Enzyme Kinetics and Inhibitor Development

Purified recombinant plsY enables detailed kinetic analyses of enzyme activity and the screening of potential inhibitors. Given the importance of membrane phospholipid biosynthesis for bacterial survival, plsY represents a potential target for novel antimicrobial agents.

Antibody Production

The recombinant protein can serve as an antigen for the production of specific antibodies against F. tularensis plsY, which can be valuable tools for detection, localization, and functional studies.

Interaction Studies

Recombinant plsY can be used in protein-protein interaction studies to identify potential binding partners and regulatory factors that influence its activity within the bacterial cell.

Role in Francisella tularensis Pathogenesis

While the specific role of plsY in F. tularensis pathogenesis is not directly addressed in the available search results, contextual information about F. tularensis pathogenicity provides valuable insights.

F. tularensis is known to invade and replicate within both macrophages and alveolar epithelial cells following inhalation . The bacterium employs sophisticated mechanisms to invade host cells, with studies suggesting that bacterial surface ligands interact with host cell receptors to trigger internalization . Once inside cells, F. tularensis must adapt to the intracellular environment and evade host defense mechanisms.

The ability to synthesize appropriate membrane phospholipids is likely critical for F. tularensis survival within host cells. As a key enzyme in phospholipid biosynthesis, plsY may contribute to membrane integrity and adaptability during infection, although specific studies on its role in virulence were not identified in the search results.

Other F. tularensis enzymes have been identified as important contributors to virulence. For example, the gluconeogenic enzyme class II fructose-1,6-bisphosphatase (FtFBPaseII) has been shown to be critical for F. tularensis virulence, highlighting the importance of metabolic enzymes in pathogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
plsY; FTF1123; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain FSC 198)
Target Names
plsY
Target Protein Sequence
MNFLNFSILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGMTNVLRIGGKVPAAITLI FDILKGLVPVVIAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGVATLIGTLFGFSW ILGLIFVITWLCVAIITRYSSLSALVATVIASFSVIFTSDLQVAAPFLIIAIIILVKHKG NIQRLISRQESKIGDKAKAKNDSN
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: ftf:FTF1123

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Francisella tularensis and why is it significant in research?

Francisella tularensis is a small, nonmotile, gram-negative coccobacillus bacterium commonly found in water, soil, and various mammals. It is the causative agent of tularemia, a potentially severe disease with various clinical presentations depending on the exposure route. F. tularensis is particularly significant in research due to its high virulence, complex intracellular lifecycle, and ability to evade host immune responses. The bacterium infects multiple sites in a host, including the skin and respiratory tract, and untreated infections can lead to a disease with historically high mortality rates . Its ability to survive within host macrophages and spread throughout the body makes it an important model for studying host-pathogen interactions and developing anti-infective strategies .

What is glycerol-3-phosphate acyltransferase (plsY) and what role does it play in F. tularensis?

Glycerol-3-phosphate acyltransferase (plsY) in F. tularensis is an enzyme involved in phospholipid biosynthesis. It catalyzes the transfer of an acyl group to glycerol-3-phosphate, an essential step in the formation of phosphatidic acid, which is a precursor for membrane phospholipids. This enzyme is also known as Acyl-PO4 G3P acyltransferase, G3P acyltransferase (GPAT), Lysophosphatidic acid synthase, and LPA synthase . The plsY gene product is critical for bacterial membrane biogenesis and potentially plays a role in the pathogen's virulence strategy, though its exact contribution to F. tularensis pathogenesis remains an area of ongoing research .

What is the relationship between plsY and the virulence mechanisms of F. tularensis?

While direct experimental evidence linking plsY specifically to F. tularensis virulence mechanisms is not extensively documented in the provided search results, the protein likely contributes to pathogenesis through its role in phospholipid biosynthesis. F. tularensis employs several sophisticated virulence strategies, including:

  • Phagosomal escape: F. tularensis enters host cells within a phagosome that begins to mature but prevents fusion with lysosomes. The bacteria then degrade the phagosomal membrane and escape into the host cytosol between 1-4 hours post-entry .

  • Membrane modifications: The unique properties of F. tularensis membranes, including its LPS and capsule, contribute significantly to immune evasion. As a membrane biosynthesis enzyme, plsY could indirectly influence these virulence determinants .

  • Protein glycosylation: Recent studies have shown that virulent F. tularensis strains produce O-antigen glycoproteins, many of which appear to be outer membrane proteins. This glycosylation, unique to virulent strains, may play a role in virulence or aid in evading host immune responses .

The membrane composition affected by plsY activity could influence these virulence mechanisms, though specific experimental validation would be required to establish direct connections.

How can recombinant plsY be used in developing attenuated vaccine strains of F. tularensis?

Developing effective vaccines against F. tularensis remains challenging due to the rapid progression of pneumonic tularemia, which often prevents the development of robust adaptive immune responses. The existing F. tularensis Live Vaccine Strain (LVS) demonstrates significant differences from virulent strains like Schu S4, including in gene expression patterns and glycosylation profiles .

Recombinant plsY could potentially contribute to vaccine development strategies through:

  • Generation of conditional mutants: Creating conditional plsY mutants could allow for controlled attenuation, potentially generating strains that survive long enough to elicit protective immunity without causing disease.

  • Adjuvant development: Recombinant plsY, if immunogenic, might serve as an adjuvant component in subunit vaccines, potentially enhancing immune recognition of other protective antigens.

  • Structure-based drug design: Understanding plsY structure could inform the development of inhibitors that might selectively attenuate virulence without completely eliminating the pathogen, potentially useful for live attenuated vaccine approaches.

  • Comparative immune response studies: Differences in plsY expression or activity between virulent strains and LVS could provide insights into mechanisms of attenuation relevant to vaccine development.

Any vaccine development strategy would need to address the challenge that successful immunity against F. tularensis likely requires stimulation of cellular immunity mechanisms that remain incompletely understood .

What are the optimal conditions for expressing and purifying recombinant F. tularensis plsY?

Based on established protocols for recombinant F. tularensis proteins, the following methodology is recommended for expressing and purifying plsY:

Expression System:

  • Host: E. coli expression systems (typically BL21 or similar strains)

  • Vector: pET or similar expression vectors with N-terminal His-tag

  • Induction: IPTG induction (typically 0.5-1.0 mM) at OD600 of 0.6-0.8

  • Temperature: Often reduced to 16-25°C during induction to improve protein folding

  • Duration: 4-16 hours of induction depending on temperature

Purification Protocol:

  • Cell lysis: Sonication or pressure-based lysis in buffer containing protease inhibitors

  • Membrane fractionation: Ultracentrifugation to isolate membrane fractions

  • Solubilization: Gentle detergents (e.g., n-dodecyl β-D-maltoside) to solubilize membrane proteins

  • Affinity chromatography: Ni-NTA or similar resin for His-tag purification

  • Buffer composition: Tris/PBS-based buffer with pH 8.0 and potentially 6% trehalose as a stabilizer

  • Storage: Lyophilization or storage in aliquots at -20°C/-80°C with 50% glycerol to prevent freeze-thaw damage

When reconstituting the purified protein, it is recommended to briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol (5-50% final concentration) is advised for long-term storage at -20°C/-80°C .

What experimental approaches can be used to study the function of plsY in F. tularensis pathogenesis?

Several experimental approaches can be employed to investigate the role of plsY in F. tularensis pathogenesis:

Genetic Approaches:

  • Gene knockout/knockdown: Generating plsY mutants using techniques adapted for F. tularensis

  • Complementation studies: Restoring plsY function in mutants to confirm phenotype specificity

  • Conditional expression: Using inducible promoters to control plsY expression temporally

Biochemical Approaches:

  • Enzyme activity assays: Measuring acyltransferase activity using purified recombinant plsY

  • Lipid profiling: Mass spectrometry analysis of phospholipid composition in wild-type versus plsY mutants

  • Protein-protein interaction studies: Identifying potential binding partners through pull-down assays or crosslinking experiments

Cellular and Infection Models:

  • Macrophage infection assays: Comparing intracellular survival and replication of wild-type versus plsY-modified strains

  • Phagosomal escape assays: Evaluating the ability of plsY mutants to escape the phagosome using fluorescence microscopy

  • Host response analysis: Measuring cytokine profiles and immune cell activation in response to infection

Animal Models:

  • Mouse infection models: Comparing virulence of wild-type versus plsY-modified strains

  • Organ bacterial burden assessment: Quantifying bacterial loads in different tissues

  • Histopathological analysis: Evaluating tissue damage and inflammatory responses

When designing these experiments, researchers should consider the established F. tularensis virulence mechanisms, including phagosomal escape mediated by Francisella Pathogenicity Island (FPI) genes, immune evasion through LPS and capsule modifications, and the potential role of glycosylated proteins in virulence .

How can researchers effectively analyze the interaction between plsY and host cell components?

Analyzing interactions between F. tularensis plsY and host cell components requires a multi-faceted approach:

Protein Localization Studies:

  • Immunofluorescence microscopy: Using antibodies against plsY to track its location during infection

  • Subcellular fractionation: Isolating different host cell compartments to detect plsY presence

  • Live-cell imaging: Using fluorescently tagged plsY to monitor dynamics during infection

Interaction Identification:

  • Co-immunoprecipitation: Pulling down plsY along with potential host binding partners

  • Yeast two-hybrid screening: Identifying potential protein-protein interactions

  • Proximity labeling approaches: Using BioID or APEX2 fusions with plsY to identify nearby proteins

  • Cross-linking mass spectrometry: Capturing transient interactions through chemical cross-linking

Functional Analysis:

  • Host membrane lipid alterations: Measuring changes in host phospholipid composition during infection

  • Metabolic labeling: Tracking the incorporation of labeled precursors into phospholipids

  • CRISPR screening: Identifying host factors that affect plsY-dependent processes

Data Analysis and Validation:

  • Bioinformatic prediction: Using algorithms to predict potential interaction sites

  • Mutational analysis: Creating targeted mutations in potential interaction domains

  • Competitive inhibition assays: Using synthetic peptides based on predicted interaction sites

These approaches should be designed with consideration of F. tularensis' intracellular lifecycle, particularly its transition from the phagosome to the cytosol, which occurs between 1-4 hours post-infection . Potential interactions with host phagosomal components, cytosolic factors, or membrane structures should be explored given the enzyme's role in phospholipid biosynthesis.

What are common challenges in working with recombinant F. tularensis proteins, and how can they be addressed?

Working with recombinant F. tularensis proteins presents several challenges:

Protein Solubility Issues:

  • Challenge: Membrane-associated proteins like plsY often have solubility problems.

  • Solution: Optimize detergent selection and concentration; consider fusion tags that enhance solubility; use specialized E. coli strains designed for membrane protein expression; explore nanodiscs or liposome reconstitution for native-like environment.

Protein Stability Concerns:

  • Challenge: Recombinant proteins may demonstrate limited stability after purification.

  • Solution: Incorporate stabilizing agents like trehalose (6%) in storage buffers; avoid repeated freeze-thaw cycles; aliquot purified proteins; consider lyophilization for long-term storage; maintain appropriate pH (typically pH 8.0 for plsY) .

Expression Level Optimization:

  • Challenge: Low expression yields of functional protein.

  • Solution: Adjust induction parameters (temperature, IPTG concentration, duration); codon-optimize gene sequence for E. coli; test multiple expression strains; consider auto-induction media.

Contamination with Endotoxin:

  • Challenge: E. coli-derived recombinant proteins may contain endotoxin.

  • Solution: Implement endotoxin removal steps during purification; consider expression in systems with modified LPS or endotoxin-free systems if the protein will be used in immunological studies.

Functional Activity Validation:

  • Challenge: Confirming that the recombinant protein retains native enzymatic activity.

  • Solution: Develop robust activity assays; compare with native protein where possible; ensure proper folding through circular dichroism or other structural analyses.

How should researchers design controls when studying the effects of plsY inhibition or mutation?

Designing appropriate controls is crucial for studies investigating plsY function:

Genetic Manipulation Controls:

  • Empty vector controls: When complementing plsY mutations, include cells carrying the empty vector.

  • Wild-type controls: Always include the unmodified parental strain.

  • Complementation controls: Restore the wild-type gene to confirm phenotype specificity.

  • Point mutation controls: Create catalytically inactive versions (e.g., active site mutations) to distinguish between enzymatic and structural roles.

Biochemical Assay Controls:

  • Heat-inactivated enzyme controls: Confirm specificity of enzymatic activity.

  • Substrate specificity controls: Test related substrates to confirm enzyme specificity.

  • Inhibitor specificity controls: Test effects on related enzymes to confirm target selectivity.

  • Time-zero controls: Establish baseline measurements for kinetic studies.

Infection Model Controls:

  • Known attenuated strain controls: Include well-characterized mutants (e.g., FPI mutants) .

  • Killed bacteria controls: Distinguish between effects requiring live bacteria versus bacterial components.

  • Heterologous expression controls: Express F. tularensis plsY in other bacteria to assess function.

  • Host cell viability controls: Monitor potential cytotoxic effects of experimental manipulations.

Data Interpretation Considerations:

  • Dose-response relationships: Establish clear relationships between intervention level and observed effects.

  • Temporal dynamics: Consider timing of observations relative to F. tularensis infection cycle.

  • Cell-type specificity: Test effects across multiple relevant host cell types (macrophages, dendritic cells, etc.).

  • Off-target effect assessment: Employ global approaches (transcriptomics, proteomics) to identify potential off-target effects.

How might plsY contribute to F. tularensis glycoprotein production and O-antigen glycosylation?

Recent research has revealed that virulent F. tularensis strains produce O-antigen glycoproteins, many of which appear to be outer membrane proteins. Interestingly, these glycosylated proteins are detectable in virulent type A and B strains but not in the attenuated LVS strain . While direct evidence linking plsY to this process is not explicitly stated in the search results, several potential connections can be hypothesized:

  • Membrane architecture influence: As a phospholipid biosynthesis enzyme, plsY affects membrane composition, potentially creating an environment conducive to glycosylation machinery function.

  • Lipid carrier interactions: Glycosylation processes often involve lipid carriers (like undecaprenyl phosphate), which exist in the same membrane environment where plsY functions.

  • Metabolic pathway connections: Phospholipid biosynthesis and glycosylation pathways may share metabolic intermediates or regulatory mechanisms.

  • Protein localization effects: PlsY activity might influence membrane microdomain formation, affecting the localization and function of glycosylation machinery.

Research approaches to investigate these possibilities could include:

  • Comparative lipidomics between virulent strains and LVS to identify phospholipid differences

  • Assessment of glycoprotein profiles in plsY conditional mutants

  • Analysis of potential physical interactions between plsY and glycosylation machinery components

  • Investigation of membrane fluidity and organization in wild-type versus plsY-modified strains

What is the potential of plsY as a target for novel antimicrobial development against F. tularensis?

Glycerol-3-phosphate acyltransferase (plsY) represents a potentially attractive antimicrobial target for several reasons:

  • Essential function: As a key enzyme in phospholipid biosynthesis, plsY likely plays an essential role in bacterial survival.

  • Structural uniqueness: Bacterial acyltransferases differ structurally from mammalian counterparts, potentially allowing for selective targeting.

  • Surface accessibility: Membrane-associated enzymes may be more accessible to small molecule inhibitors than cytoplasmic targets.

  • Limited bypass pathways: Phospholipid biosynthesis pathways often have limited redundancy, reducing the potential for resistance development.

Approaches for developing plsY-targeted antimicrobials could include:

Target Validation Strategies:

  • Conditional knockdown studies to confirm essentiality

  • Structural determination of F. tularensis plsY

  • Biochemical characterization of enzyme kinetics and substrate specificity

Drug Discovery Approaches:

  • High-throughput screening of small molecule libraries against purified recombinant plsY

  • Structure-based design of inhibitors targeting the active site

  • Fragment-based drug discovery approaches

  • Natural product screening for acyltransferase inhibitors

Efficacy Testing Models:

  • In vitro enzyme inhibition assays

  • Bacterial growth inhibition assays

  • Intracellular infection models using macrophages

  • Mouse models of tularemia

Delivery Strategies:

  • Liposomal formulations to enhance delivery to intracellular bacteria

  • Conjugation with cell-penetrating peptides

  • Co-administration with compounds that enhance phagosomal penetration

Development of plsY inhibitors could potentially address the challenge of treatment resistance and might be particularly valuable against intracellular pathogens like F. tularensis that can escape from the phagosome and replicate in the cytosol .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.