Recombinant Francisella tularensis subsp. tularensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of MsbA

The Francisella tularensis subsp. tularensis Lipid A export ATP-binding/permease protein MsbA (msbA) is a critical component of the bacterial lipid A-core biosynthesis pathway. It belongs to the ATP-binding cassette (ABC) transporter family and facilitates the translocation of lipid A-core precursors across the inner membrane, enabling lipopolysaccharide (LPS) assembly. This protein is essential for bacterial survival and pathogenicity, as LPS integrity is crucial for immune evasion and outer membrane stability.

Functional Roles

  • Lipid A Export: MsbA transports lipid A-core precursors across the inner membrane, enabling subsequent modifications (e.g., phosphorylation, acylation) and LPS assembly.

  • Interaction with Lpx Proteins: MsbA collaborates with lipid A biosynthesis enzymes (e.g., LpxE, LpxF) to dephosphorylate lipid A at the 1′ and 4′ positions, reducing Toll-like receptor 4 (TLR4) activation and enhancing immune evasion .

  • Essential for Virulence: Mutations in msbA or related ABC transporters disrupt LPS biogenesis, attenuating F. tularensis pathogenicity .

Critical Domains and Motifs:

Domain/MotifFunctionSource
Walker A/B MotifsATP hydrolysis for energy-dependent transport
Transmembrane HelicesSubstrate binding and membrane integration

Research Findings and Mechanistic Insights

3.1 Role in LPS Biogenesis
MsbA is indispensable for lipid A-core export. In E. coli mutants lacking MsbA, lipid A precursors accumulate in the cytoplasm, and LPS biogenesis halts . This dependency is conserved in F. tularensis, where MsbA interacts with Lpx proteins to finalize lipid A modifications.

3.2 Impact on Immune Evasion
F. tularensis lipid A is tetra-acylated with long-chain fatty acids (C16–C18), unlike the hexa-acylated lipid A of E. coli. MsbA’s role in exporting lipid A-core precursors ensures proper acylation, which reduces TLR4-mediated immune recognition .

Experimental Validation

  • E. coli Model Systems: Expression of F. tularensis MsbA in E. coli restored lipid A export, enabling studies on its substrate specificity .

  • Mass Spectrometry: Analyses of F. tularensis mutants revealed altered lipid A acylation patterns, confirming MsbA’s role in acyltransferase coordination .

Applications in Research and Diagnostics

4.1 Recombinant Protein Utilization
Recombinant MsbA is used in structural and functional studies, including:

  • ELISA Development: Monoclonal antibodies targeting MsbA enable detection in clinical or environmental samples .

  • Therapeutic Targeting: Inhibitors of MsbA could disrupt LPS biogenesis, offering a novel antimicrobial strategy.

4.2 Diagnostic Potential
While existing assays focus on F. tularensis LPS, MsbA-specific ELISA kits ( ) provide an alternative for detecting bacterial components in contaminated matrices (e.g., soil, serum).

Future Directions

  • Structural Elucidation: Cryo-EM or X-ray crystallography studies to resolve MsbA’s conformational changes during substrate transport.

  • Therapeutic Development: High-throughput screening for small-molecule inhibitors targeting MsbA’s ATP-binding or substrate-binding domains.

  • Host-Pathogen Interactions: Investigating MsbA’s role in modulating host immune responses during F. tularensis infection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msbA; FTF0109; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain FSC 198)
Target Names
msbA
Target Protein Sequence
MANMIDKIDLKSQGSSNLSGEMTNHQKVGTLYKRLLLQVKHLWHFLLLAAIGSIFFSAAD ASMIYLINPILNYGFGPGGGITKQSATILMLMGVGMVGLLALRSVGSFVSQYFIGSLGQK VVYKFRKDIYKRLMDLPASFFDKHSTGQIISRLLYNVDQVIEATSTAIITVVQDGTFVIG LIVVMFVSSWQLSLFLIVVGPFLGLFISIINKKFRNLSRNTQSSMGNVTHTAEETIRNYK EIRIFGAQQKQQNKFFKNLDYTYSQQIRTIALDALTSPVIQIIASLVLAFSLFTIAIFGT NEGDGSSWLTAGSFASFFAAAAAILKPIKNLTKVNVVIQKAVAATEDIFYILDYPAEKET GSKELAKVDGNVTIKDLSFAFGEHKVLSGVSVDIKAGQTVAFVGKSGSGKTTLTSIISRF YTQHEGEILLDGVDTRELTLENLRSHLSIVSQNVHLFDDTVYNNIAFGLSREVSEEEVID ALKRANAYEFVQELSDGINTNIGNNGSKLSGGQRQRISIARALLKNAPVLIFDEATSALD NESERVVQQALESLTKSCTTIVIAHRLSTVENADKIVVMDGGRVVESGKHQELLEQGGLY TRLYQSGLQ
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.
Database Links

KEGG: ftf:FTF0109

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Lipid A export ATP-binding/permease protein MsbA in F. tularensis?

MsbA is a critical membrane protein in Francisella tularensis with ATP-binding and permease activities (EC 3.6.3.-). The protein plays an essential role in lipopolysaccharide (LPS) biogenesis by facilitating the transport of lipid A across bacterial membranes. In F. tularensis subsp. tularensis strain FSC 198, MsbA is encoded by the msbA gene (locus tag FTF0109) and consists of 609 amino acids . The protein contains characteristic transmembrane domains and nucleotide-binding domains typical of ABC transporters, enabling it to couple ATP hydrolysis with substrate translocation across the membrane .

How does F. tularensis LPS structure differ from other gram-negative bacteria?

Unlike typical gram-negative bacteria, F. tularensis has unique modifications in its LPS structure that contribute to its virulence and immune evasion capabilities. The core sugar components and the O-antigen ligation to these core sugars are facilitated by specific biosynthetic genes, including those similar to waa (rfa) genes found in other bacteria . Research has identified genes such as FTT1236, FTT1237, and FTT1238c in F. tularensis that are involved in LPS core sugar biosynthesis and O-antigen ligation, which have been named waaY, waaZ, and waaL, respectively . While these proteins share functional similarities with those in Escherichia coli or Salmonella enterica, they are not exact orthologs, highlighting the uniqueness of F. tularensis LPS biosynthesis machinery .

What detection methods are available for F. tularensis in laboratory settings?

F. tularensis detection employs several methodological approaches:

  • Culture-based methods: F. tularensis requires enriched media for growth, including cysteine glucose blood agar, enriched chocolate agar (CHAB), and buffered charcoal yeast extract agar . Visible growth typically appears after 18 hours with a heavy inoculum, but individual colonies may require 2-4 days of incubation .

  • Immunoassay methods: Several antibody-based detection methods have been developed:

    • LPS-targeting assays with sensitivity of 10³ CFU/ml in PBS and 10⁴ CFU/ml in human sera

    • Immunochromatographic hand-held assays (detection limit: 10⁶-10⁷ CFU/ml in spiked human sera)

    • Novel sandwich immunoassays targeting outer membrane protein A (FopA), with detection limits as low as 0.066-0.074 ng/ml in various matrices including human serum, bovine serum albumin, mouse urine, and soil water

  • Serological tests: Agglutination tests are commonly used, with titers greater than 1:20 considered specific and significant. A fourfold increase during illness or a single titer of 1:160 or greater is considered diagnostic .

  • PCR-based assays: These offer increased sensitivity and specificity for detection of F. tularensis genetic material .

What expression systems are most effective for producing recombinant F. tularensis MsbA?

Based on the available research data, insect cell expression systems have proven effective for expressing recombinant proteins from F. tularensis. For example, ExpiSf9™ cells have been successfully used at a density of 5 × 10⁶ cells/mL with ≥90% viability for expressing recombinant F. tularensis outer membrane proteins . The baculovirus expression system offers several advantages for membrane proteins like MsbA:

  • Post-translational modifications more similar to mammalian cells

  • Better folding of complex membrane proteins

  • Higher yields of functional protein

The expression protocol involves:

  • Seeding cells and adding ExpiSf™ Enhancer

  • Infection with recombinant baculovirus (MOI of 5)

  • Harvesting supernatants after 120 hours post-infection

  • Centrifugation at 4,000 rpm for 30 minutes

  • Filtration using a 0.22-μm bottle top vacuum filter

What are the optimal purification strategies for maintaining native structure of recombinant MsbA?

Purification of MsbA requires careful handling to maintain its native structure and function. Based on protocols used for similar membrane proteins from F. tularensis, a multi-step purification process is recommended:

  • Initial purification: Using affinity chromatography with His-tag purification systems such as cOmplete™ His-Tag Purification Column equipped with chromatography systems like NGC QUEST 100

  • Elution conditions: Eluting the protein with an imidazole gradient, with optimal elution occurring at approximately 80mM imidazole in PBS buffer

  • Post-purification processing: Dialysis against PBS (pH 7.4) to remove imidazole and other contaminants

  • Storage conditions: For recombinant proteins from F. tularensis, storage in Tris-based buffer with 50% glycerol is recommended. Store at -20°C, or -80°C for extended storage. Working aliquots can be stored at 4°C for up to one week, avoiding repeated freeze-thaw cycles .

How does MsbA contribute to F. tularensis pathogenesis and virulence?

MsbA plays a critical role in F. tularensis pathogenesis through its function in lipopolysaccharide (LPS) biosynthesis and transport. LPS is a key virulence determinant in F. tularensis, and disruptions in LPS biosynthesis pathways significantly impact the bacterium's ability to cause disease .

The relationship between LPS and virulence is evidenced by studies on mutant strains with defects in LPS biosynthesis genes, which show:

  • Increased LD₅₀ values: Mutations in LPS biosynthesis genes like waaY, waaZ, and waaL (involved in core sugar biosynthesis and O-antigen ligation) result in 100- to 1,000-fold increases in LD₅₀ values in mice

  • Altered immune responses: Wild-type and LPS mutant strains elicit distinctly different immune responses in infected tissues:

    • In lungs: Mutant strains cause widespread necrotic debris, while wild-type infections show nominal necrosis

    • In spleens: Mutant infections lack necrosis and display neutrophilia, while wild-type infections cause widespread necrosis

  • Different pathogenesis mechanisms: These pathological differences suggest that murine death caused by wild-type strains occurs by a mechanism different from that of mutant strains

As MsbA is involved in lipid A transport, which is essential for proper LPS assembly, disruptions in MsbA function would likely result in similar attenuation of virulence.

What experimental approaches are used to study MsbA function in lipid A transport?

Studying MsbA function in lipid A transport requires specialized approaches due to the challenges of working with membrane proteins and the pathogenic nature of F. tularensis. Several methodological approaches can be employed:

  • Genetic approaches:

    • Construction of deletion or point mutations in the msbA gene

    • Complementation studies to confirm phenotypes

    • Targetron system for site-directed mutagenesis, as used for similar genes in F. tularensis

  • Biochemical approaches:

    • ATPase activity assays to measure the ATP hydrolysis function

    • Lipid binding and transport assays using fluorescently labeled lipid substrates

    • Reconstitution of purified MsbA into liposomes to study transport in vitro

  • Structural approaches:

    • Protein crystallography or cryo-EM studies to determine MsbA structure

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) to study conformational changes

  • Cell-based approaches:

    • Assessment of LPS profiles in wild-type versus msbA mutant strains

    • Membrane permeability assays

    • Analysis of lipid distribution across membrane leaflets

How can researchers develop specific antibodies against F. tularensis MsbA?

Development of specific antibodies against F. tularensis MsbA can follow this methodological framework:

  • Antigen preparation:

    • Express recombinant MsbA protein using baculovirus expression systems in insect cells (e.g., ExpiSf9™ cells)

    • Purify using affinity chromatography (His-tag purification columns)

    • Verify protein quality by SDS-PAGE and Western blotting

  • Immunization protocol:

    • Use 5-week-old female BALB/c mice for immunization with purified recombinant MsbA

    • Follow established immunization schedules with appropriate adjuvants

    • Monitor antibody titers using ELISA

  • Hybridoma generation and screening:

    • Generate hybridomas following standard protocols

    • Screen hybridomas to identify monoclonal antibodies (mAbs) against recombinant MsbA by ELISA

    • Synthesize cDNA of hybridoma cells using random hexamer primers

    • Identify antibody VH and VL chain genes using PCR methods

  • Antibody validation:

    • Test specificity using Western blot against recombinant protein and native protein from F. tularensis

    • Evaluate cross-reactivity with related proteins

    • Determine binding affinity using methods such as surface plasmon resonance

  • Antibody characterization:

    • Determine epitope specificity through epitope mapping

    • Assess functionality in different applications (ELISA, Western blot, immunoprecipitation)

    • Test performance in various matrices (PBS, serum, etc.)

How can sandwich immunoassays be optimized for detecting F. tularensis antigens in complex matrices?

Optimization of sandwich immunoassays for F. tularensis antigens requires careful consideration of multiple factors:

  • Antibody pair selection:

    • Screen different monoclonal antibody pairs to identify optimal capture and detector antibodies

    • Ensure antibodies target non-overlapping epitopes

    • For maximum sensitivity, use biotinylated detector antibodies with streptavidin-HRP conjugates

  • Assay optimization protocol:

    • Coat capture mAb (at optimal concentration, e.g., 50 nM) on 96-well plates and incubate overnight at 4°C

    • Block with 3% BSA/PBS for one hour

    • Add serial dilutions of antigen in appropriate buffer

    • Incubate with biotinylated detector mAb (e.g., 20 nM) for one hour at room temperature

    • Add HRP-conjugated streptavidin and develop with appropriate substrate

  • Matrix effect evaluation:

    • Test assay performance in various matrices relevant to research applications:

      • Human serum (3%)

      • Bovine serum albumin (3%)

      • Mouse urine

      • Soil water

      • PBS (as control)

  • Analytical performance assessment:

    • Determine limit of detection (LoD) in each matrix using linear regression analysis

    • Evaluate precision and reproducibility

    • Assess specificity against related bacterial species

MatrixLimit of Detection (ng/mL)
Human serum (3%)0.066
Bovine serum albumin (3%)0.074
Mouse urine0.071
PBS/Control0.070 (approximate)
Soil water0.072 (approximate)

Data derived from research on similar F. tularensis outer membrane proteins shows minimal matrix effects on detection sensitivity, with LoD values ranging from 0.066 to 0.074 ng/mL across different matrices .

How do mutations in LPS biosynthesis genes affect F. tularensis virulence in animal models?

Studies on LPS biosynthesis gene mutations in F. tularensis have revealed significant impacts on virulence and host responses in animal models:

  • Virulence attenuation:

    • Mutations in genes involved in LPS core sugar biosynthesis and O-antigen ligation (waaY, waaZ, and waaL) result in 100- to 1,000-fold increases in LD₅₀ values in mice

    • This demonstrates the critical importance of intact LPS for full virulence

  • Altered tissue pathology:

    • In mice infected with LPS mutant strains:

      • Lung tissue shows widespread necrotic debris

      • Spleen tissue lacks necrosis but displays neutrophilia

    • In contrast, mice infected with wild-type strains:

      • Lung tissue shows nominal necrosis

      • Spleen tissue shows widespread necrosis

  • Different pathogenesis mechanisms:

    • The distinct pathological patterns suggest that wild-type and mutant strains cause mortality through different mechanisms

  • Protective immunity:

    • Mice immunized with LPS mutant strains displayed >10-fold protective effects against virulent type A F. tularensis challenge

    • This suggests potential applications in vaccine development

These findings highlight the complex relationship between LPS structure and F. tularensis pathogenesis, with implications for understanding MsbA's role in virulence as a key protein in LPS biosynthesis.

What challenges exist in differentiating between subspecies of F. tularensis in research settings?

Differentiation between F. tularensis subspecies presents several methodological challenges:

  • Growth characteristics:

    • F. tularensis is fastidious, requiring enriched media for growth

    • Incubation times vary, with individual colonies potentially requiring 2-4 days to appear

    • Subspecies may have subtle differences in growth requirements or colony morphology

  • Antigenic differences:

    • Some F. tularensis strains may fail to agglutinate with commercially available antigens

    • LPS variation between subspecies affects serological test performance

    • Subspecies novicida has distinct LPS characteristics that affect recognition by anti-LPS antibodies

  • Molecular detection challenges:

    • PCR-based assays must be designed to target regions that differ between subspecies

    • Sequence similarities between subspecies can complicate specific detection

    • Need for multiple genetic markers to reliably distinguish subspecies

  • Immunoassay cross-reactivity:

    • Antibodies developed against one subspecies may cross-react with others

    • Careful validation required to ensure subspecies-specific detection

    • Novel approaches targeting proteins like FopA show promise for specific detection

  • Biosafety considerations:

    • F. tularensis is classified as a Tier 1 Select agent by the CDC

    • Different subspecies have varying levels of virulence and handling requirements

    • Research requires appropriate containment facilities and trained personnel

What emerging technologies show promise for studying F. tularensis MsbA structure-function relationships?

Several cutting-edge technologies are advancing our understanding of membrane proteins like MsbA:

  • Cryo-electron microscopy (Cryo-EM):

    • Allows visualization of membrane proteins in near-native environments

    • Can capture different conformational states during transport cycle

    • Does not require protein crystallization, which is challenging for membrane proteins

  • Nanodiscs and lipid cubic phase technologies:

    • Better mimic native membrane environments

    • Improve stability and functionality of purified MsbA

    • Enable biophysical studies in more physiologically relevant conditions

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes during transport

    • Atomic force microscopy to study mechanical properties

    • Single-molecule transport assays to directly observe substrate movement

  • Computational approaches:

    • Molecular dynamics simulations to predict structural changes

    • Machine learning algorithms to identify structure-function relationships

    • In silico screening for potential inhibitors targeting MsbA

  • CRISPR-Cas9 genome editing:

    • Precise manipulation of msbA gene in F. tularensis

    • Creation of conditional mutants to study essential functions

    • Introduction of reporter tags for live-cell imaging

How might targeting MsbA contribute to new therapeutic approaches against tularemia?

Targeting MsbA represents a promising therapeutic strategy against tularemia for several reasons:

  • Essential function:

    • MsbA plays a critical role in LPS biosynthesis, which is essential for bacterial viability

    • Inhibiting MsbA function could potentially disrupt membrane integrity and bacterial survival

  • Therapeutic potential:

    • Development of small molecule inhibitors specifically targeting MsbA

    • Structure-based drug design using solved MsbA structures

    • Screening of compound libraries for MsbA inhibitors

  • Combination therapy approaches:

    • MsbA inhibitors could potentially increase bacterial susceptibility to existing antibiotics

    • Synergistic effects with drugs targeting other aspects of LPS biosynthesis

    • Multi-target approaches to reduce development of resistance

  • Vaccine development:

    • MsbA or its fragments could serve as potential vaccine antigens

    • Attenuated strains with modified MsbA function may provide protective immunity

    • Studies show that LPS mutant strains can evoke protection against lethal Schu S4 challenge in mice

  • Diagnostic applications:

    • Development of sensitive and specific detection methods targeting MsbA

    • Point-of-care diagnostic tools for rapid tularemia detection

    • Differentiation between subspecies based on MsbA variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.