Recombinant Francisella tularensis subsp. tularensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant YidC

YidC is a universally conserved membrane insertase that mediates the integration of proteins into bacterial membranes. In Francisella tularensis, YidC is essential for virulence, as it modulates host immune responses by inhibiting Interferon Regulatory Transcription Factor 1 (IRF1) activation . Recombinant YidC produced in E. coli enables researchers to study its structural and functional properties without handling the pathogenic F. tularensis strain .

Functional Mechanisms

YidC operates via two pathways:

  1. Sec-Independent Insertion: Directly integrates small proteins (e.g., Pf3 coat protein) by widening its TM groove to form a "hydrophobic slide," enabling substrate entry into the lipid bilayer .

  2. SecYEG Chaperone: Assists the Sec translocon in inserting large, multi-spanning membrane proteins .

Key dynamics include:

  • Conformational Changes: TM helices expand by >10° during substrate insertion, driven by cytoplasmic loop interactions .

  • Water-Mediated Insertion: A transient "water slide" hydrates the hydrophilic groove, lowering the energy barrier for substrate entry .

Role in Virulence

  • Deletion of yidC in F. tularensis impairs IRF1 inhibition, increasing bacterial susceptibility to IFN-γ-mediated host defenses .

  • Mutants show reduced survival in macrophages, highlighting YidC’s role in evading immune responses .

Applications and Implications

  • Drug Development: Targeting YidC’s hydrophilic groove or cytoplasmic loops could disrupt bacterial membrane protein biogenesis .

  • Vaccine Research: Recombinant YidC aids in identifying epitopes for subunit vaccines against tularemia .

Technical Notes

  • Storage Stability: Lyophilized YidC retains activity for 12 months at -80°C; avoid repeated freeze-thaw cycles .

  • Activity Assays: Functional validation via protease protection assays or Sec-dependent/independent substrate insertion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
yidC; FTW_1856; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain WY96-3418)
Target Names
yidC
Target Protein Sequence
MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNSHYDNADSSTNTDVTT TDAKSSLAKETNFSKYDNAKSITINTGVFKDVKVSLLDGAIISASLKDYSISLDDKTPMS LLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKIENGKQILTLTGSADGLQITRTYTFDD TKYNISVSQNIKNTTSAPVNVIVDDSFARDFDPAGDSFSLLNAHSYTFTGVAYSTAKDSF RKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQSTNAKIYYKNLNGDVFEAGA FTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNHIHS LVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETYKDDRQALGKKMM ELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPV LMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFASFPSGLVLYWLTNNLISISQQWI ITRHYQATHKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins within the membrane. It plays a role in the integration of membrane proteins, both those that depend on and those that are independent of the Sec translocase complex, as well as certain lipoproteins. It assists in the folding of multispanning membrane proteins.
Database Links

KEGG: ftw:FTW_1856

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of YidC in Francisella tularensis?

YidC in Francisella tularensis functions as a membrane protein insertase essential for the integration of various membrane proteins into the bacterial cell membrane. As part of the membrane protein biogenesis machinery, YidC facilitates proper folding and assembly of proteins critical for bacterial survival and virulence. The protein contains multiple transmembrane domains that interact with nascent membrane proteins, guiding their insertion into the lipid bilayer. YidC can function independently or in cooperation with the Sec translocon complex, depending on the substrate proteins. In Francisella species, YidC shares structural similarities with the YidC found in other gram-negative bacteria, including the highly conserved hydrophobic core domains essential for insertase activity .

What expression systems are most effective for producing recombinant F. tularensis YidC?

For recombinant production of F. tularensis YidC, E. coli-based expression systems have proven most effective, particularly when the protein is tagged with purification handles such as polyhistidine (His) tags. Based on successful approaches with related proteins, the following expression systems are recommended:

  • E. coli BL21(DE3) with pET vector systems: This combination allows for IPTG-inducible expression with tight control over expression levels, critical for membrane proteins that can be toxic when overexpressed .

  • E. coli C43(DE3) or C41(DE3): These Walker strains, derivatives of BL21(DE3), are specifically engineered to handle membrane protein expression and can reduce toxicity issues.

  • Arabinose-inducible systems: pBAD vectors with fine-tunable expression provide an alternative approach for proteins that are difficult to express.

Expression should be optimized by testing multiple temperatures (typically 16-30°C), inducer concentrations, and induction times. Addition of membrane-stabilizing agents such as glycerol (5-10%) to growth media can improve yield and stability of the recombinant protein.

What is the optimal protocol for purification of recombinant His-tagged F. tularensis YidC?

The optimal purification protocol for His-tagged F. tularensis YidC involves multiple steps designed to maintain the native conformation of this integral membrane protein:

  • Cell lysis and membrane isolation:

    • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl with protease inhibitor cocktail

    • Disrupt cells via sonication or high-pressure homogenization

    • Remove unbroken cells and debris by centrifugation (10,000 × g for 20 minutes)

    • Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Membrane protein solubilization:

    • Resuspend membrane pellet in solubilization buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and detergent

    • Test multiple detergents (DDM, LDAO, or C12E8) at 1-2% concentration

    • Gently stir for 1-2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (100,000 × g for 45 minutes)

  • Immobilized metal affinity chromatography (IMAC):

    • Load solubilized material onto Ni-NTA or TALON resin pre-equilibrated with wash buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% detergent, 20 mM imidazole)

    • Wash with 10 column volumes of wash buffer

    • Elute protein with elution buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% detergent, 250-500 mM imidazole)

  • Size exclusion chromatography (SEC):

    • Further purify by SEC using Superdex 200 column

    • Use buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 0.05% detergent

    • Collect fractions containing pure YidC protein

  • Storage:

    • Store purified protein at -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Consider adding 10% glycerol as cryoprotectant

This protocol typically yields 1-3 mg of purified YidC protein per liter of bacterial culture, with >90% purity as assessed by SDS-PAGE.

How can researchers assess the functional activity of purified recombinant YidC?

Assessing functional activity of purified recombinant YidC requires multiple complementary approaches:

  • In vitro translation/insertion assays:

    • Prepare liposomes from E. coli polar lipid extract

    • Reconstitute purified YidC into liposomes

    • Add model substrate proteins (e.g., Pf3 coat protein) to the translation mixture

    • Analyze insertion using protease protection assays and SDS-PAGE/autoradiography

    • Include appropriate controls (liposomes without YidC, heat-inactivated YidC)

  • Cross-linking studies:

    • Use photo-activatable or chemical cross-linkers to identify YidC interactions with substrate proteins

    • Analyze cross-linked products by immunoprecipitation and mass spectrometry

  • Complementation assays:

    • Transform YidC-depleted bacterial strains with plasmids expressing F. tularensis YidC

    • Assess growth restoration under YidC-depleting conditions

    • Compare growth curves and colony formation with positive and negative controls

  • Binding assays:

    • Use surface plasmon resonance or microscale thermophoresis to measure binding affinities

    • Analyze interaction with known YidC substrates or components of the translocation machinery

Active YidC should demonstrate specific binding to substrate proteins, facilitate membrane insertion in reconstituted systems, and restore growth in complementation assays. Quantitative analysis comparing wild-type and mutant versions can provide insights into structure-function relationships.

What are the key considerations when designing genetic knockout studies for yidC in F. tularensis?

Designing genetic knockout studies for yidC in F. tularensis requires careful consideration of several critical factors:

  • Essential gene status assessment:

    • YidC is likely essential, necessitating conditional knockout strategies

    • Implement inducible expression systems (tetracycline-responsive) to maintain viability during manipulation

  • Knockout strategy design:

    • Create suicide plasmid vectors containing flanking regions of yidC gene

    • Consider the high efficiency of homologous recombination systems in F. tularensis

    • Include selectable markers and counter-selection systems (e.g., sacB for sucrose sensitivity)

  • Biosafety considerations:

    • Work must be conducted in appropriate Biosafety Level 3 facilities due to F. tularensis pathogenicity

    • Consider using attenuated strains like F. tularensis subsp. holarctica 15 NIIEG as a safer alternative

  • Verification methods:

    • PCR analysis with primers flanking the deletion site

    • Sequencing to confirm precise modification

    • Western blot analysis to verify protein absence

    • RT-qPCR to confirm transcriptional changes

  • Phenotypic characterization:

    • Growth kinetics in various media

    • Stress response assessment

    • Invasion and intracellular replication in macrophage cell lines

    • Mouse infection models for virulence assessment

  • Control considerations:

    • Include complementation studies with wild-type yidC to confirm phenotype specificity

    • Create point mutations in critical residues as alternatives to complete knockout

Knockout studies in F. tularensis subsp. holarctica have shown that deletion of certain genes can significantly reduce virulence while maintaining viability, as demonstrated with the recD deletion strain . Similar approaches may be applicable to studying YidC function through partial deletions or domain mutations.

How does YidC function differ between F. tularensis subspecies and what implications does this have for pathogenesis?

YidC function across F. tularensis subspecies demonstrates both conservation and subspecies-specific adaptations that may contribute to differences in virulence and host tropism:

  • Sequence and structural variations:

    • F. tularensis subsp. tularensis (Type A) typically shows higher sequence conservation of essential proteins like YidC compared to less virulent subspecies

    • F. tularensis subsp. holarctica (Type B) exhibits slight variations in the periplasmic domains that may affect substrate specificity

    • F. philomiragia demonstrates greater sequence divergence while maintaining core functional domains

  • Substrate profiles:

    • Different subspecies likely have varied YidC-dependent membrane proteomes

    • Type A strains may utilize YidC to insert specialized virulence factors absent in less pathogenic strains

    • Variations in YidC may affect insertion efficiency of proteins involved in stress response, such as peptide methionine sulfoxide reductases (MsrA and MsrB)

  • Integration with stress response systems:

    • YidC function is closely linked to bacterial adaptation to host environments

    • More virulent subspecies demonstrate enhanced ability to respond to oxidative stress and temperature shifts

    • YidC may facilitate insertion of membrane proteins involved in these adaptive responses

  • Implications for pathogenesis:

    • YidC-mediated insertion of specific virulence factors likely contributes to the higher mortality rate (up to 60%) in untreated Type A infections compared to Type B

    • Differences in YidC function may impact bacterial escape from phagosomes and replication in macrophages

    • Subspecies-specific YidC activity potentially affects bacterial adaptation to different host environments

The ability of F. tularensis to transition between environmental reservoirs, vectors, and mammalian hosts requires adaptation to diverse hostile conditions (temperature changes, reactive oxygen species, low pH) . YidC likely plays a critical role in this adaptation by ensuring proper insertion of stress response proteins and virulence factors specific to each subspecies.

What role might YidC play in F. tularensis biofilm formation and environmental persistence?

YidC likely serves as a critical mediator in F. tularensis biofilm formation and environmental persistence through several mechanisms:

  • Insertion of adhesion factors:

    • YidC facilitates membrane insertion of proteins involved in initial attachment to surfaces

    • Surface-exposed adhesins and autotransporters dependent on YidC for proper folding are critical for biofilm initiation

  • Integration with chitinase expression:

    • F. tularensis expresses multiple chitinases (ChiA, ChiB, and FTS_1749) that have been implicated in biofilm formation regulation

    • YidC may be responsible for proper membrane integration of chitinase secretion machinery

    • Studies in F. novicida have shown that chitinases possess anti-biofilm properties, suggesting complex regulatory networks

  • Stress response during environmental persistence:

    • YidC inserts key membrane proteins involved in response to environmental stressors

    • Peptide methionine sulfoxide reductases (MsrA and MsrB), which are repair enzymes for oxidation-inactivated proteins, require proper membrane localization

    • These enzymes are upregulated in early infection stages and likely play roles in environmental persistence

  • Cold adaptation mechanisms:

    • F. tularensis can persist in cold-blooded hosts and low-temperature environments

    • Membrane fluidity adaptations require YidC-dependent insertion of specialized membrane proteins

    • YidC activity at lower temperatures may be a key factor in the remarkable environmental adaptability of F. tularensis

The bacteria's broad range of environmental reservoirs, including insects, arthropods, and freshwater protozoans, demonstrates remarkable adaptability that likely depends on YidC-mediated membrane protein insertion pathways . Targeting YidC function may provide novel approaches to limiting environmental persistence of this pathogen.

How can structural studies of YidC inform the development of novel antimicrobials against F. tularensis?

Structural studies of F. tularensis YidC can significantly advance antimicrobial development through multiple approaches:

  • Identification of druggable binding pockets:

    • High-resolution structures obtained through X-ray crystallography or cryo-EM can reveal unique binding sites

    • Comparative analysis with human membrane proteins can identify bacterial-specific features

    • Molecular dynamics simulations can determine the stability and accessibility of potential binding pockets

  • Structure-based drug design opportunities:

    • The hydrophobic core of YidC contains the substrate binding site that is essential for function

    • Small molecules designed to occupy this region could block substrate binding

    • The periplasmic domain contains regions that interact with the Sec translocon and represents another potential target

  • Critical residue identification:

    • Site-directed mutagenesis based on structural insights can identify residues essential for:

      • Substrate recognition

      • Membrane insertion activity

      • Interaction with accessory proteins

    • These critical residues become primary targets for inhibitor design

  • Exploiting subspecies-specific features:

    • Structural comparison between YidC from highly virulent F. tularensis subsp. tularensis and less pathogenic subspecies

    • Identification of structural elements that correlate with enhanced virulence

    • Development of inhibitors specific to the most dangerous subspecies

  • Potential for broad-spectrum applications:

    • YidC is conserved across bacterial species but divergent from mammalian systems

    • Structural studies of F. tularensis YidC can inform development of broad-spectrum antibiotics

    • Comparison with YidC structures from other priority pathogens can identify common targetable features

The recombinant expression systems for F. tularensis YidC provide the necessary foundation for these structural studies, while insights from related bacteria can guide initial approaches. As F. tularensis has developed resistance to various antibiotics, targeting the essential YidC pathway represents a promising alternative therapeutic strategy.

What are the major challenges in expressing and purifying functional F. tularensis YidC and how can they be overcome?

Expressing and purifying functional F. tularensis YidC presents several technical challenges with corresponding solutions:

ChallengeUnderlying IssueSolution Strategies
Low expression levelsToxicity to host cells due to membrane protein overexpression- Use tightly regulated expression systems (pET with T7 lysozyme co-expression)
- Lower induction temperatures (16-20°C)
- Reduce inducer concentration
- Use specialized host strains (C43/C41)
Inclusion body formationImproper folding and aggregation- Optimize expression conditions (lower temperature, slower induction)
- Co-express chaperones (GroEL/GroES)
- Add membrane-stabilizing agents to media
- Consider fusion partners (MBP, SUMO)
Detergent selectionFinding detergents that maintain native structure- Screen multiple detergents (DDM, LDAO, C12E8)
- Use detergent stability assays
- Consider nanodisc or SMALPs for detergent-free purification
- Perform activity assays in each detergent
Protein instabilityDegradation during purification- Include protease inhibitor cocktails
- Maintain samples at 4°C throughout purification
- Add stabilizing agents (glycerol, specific lipids)
- Minimize purification duration
Low purityCo-purification of contaminants- Implement two-step tagging (His-tag plus additional affinity tag)
- Include ion exchange chromatography step
- Optimize imidazole concentrations in wash buffers
- Consider on-column detergent exchange

Researchers have successfully expressed and purified F. philomiragia YidC using E. coli expression systems with N-terminal His-tags , suggesting similar approaches may work for F. tularensis YidC. The lyophilized protein format allows for long-term storage while maintaining functional integrity, though researchers should aliquot reconstituted protein to avoid repeated freeze-thaw cycles .

How can researchers differentiate between direct and indirect effects when studying YidC function in F. tularensis?

Differentiating between direct and indirect effects when studying YidC function requires systematic experimental approaches:

  • Conditional expression systems:

    • Implement tunable promoters to create YidC depletion strains

    • Monitor phenotypic changes at various YidC expression levels

    • Rapid effects upon depletion likely represent direct YidC functions

    • Delayed effects may indicate secondary consequences

  • Time-course proteomic analysis:

    • Perform quantitative proteomics at multiple timepoints following YidC depletion

    • Identify proteins showing earliest abundance changes

    • Classify membrane proteins versus cytosolic proteins

    • Construct network maps of affected pathways

  • Direct binding assays:

    • Perform co-immunoprecipitation with tagged YidC

    • Use crosslinking coupled with mass spectrometry (XL-MS)

    • Employ bacterial two-hybrid systems to identify direct interaction partners

    • Validate interactions through purified component reconstitution

  • In vitro reconstitution experiments:

    • Reconstitute purified YidC into liposomes

    • Test insertion of candidate substrate proteins directly

    • Compare with control liposomes lacking YidC

    • Effects observed in this minimal system likely represent direct YidC functions

  • Structure-function analysis:

    • Generate point mutations in key YidC functional domains

    • Assess specific functions affected by each mutation

    • Correlate structural changes with functional defects

    • Compare with global depletion phenotypes

  • Specialized controls:

    • Include depletion of other membrane protein biogenesis factors (Sec pathway components)

    • Compare phenotypes to distinguish YidC-specific effects

    • Use temperature-sensitive alleles for rapid inactivation studies

F. tularensis studies should consider the bacterium's unique lifestyle in macrophages, where altered vacuole maturation and escape into the cytosol may be directly or indirectly influenced by YidC-dependent membrane proteins.

What biosafety considerations must researchers address when working with F. tularensis YidC, and what alternatives exist?

Working with F. tularensis requires strict biosafety measures due to its high pathogenicity, with several alternatives available for YidC research:

  • Biosafety requirements for F. tularensis research:

    • Biosafety Level 3 (BSL-3) facilities required for F. tularensis subsp. tularensis

    • Specialized training in high-containment practices

    • Biological safety cabinets, controlled air handling, and decontamination protocols

    • Restricted access and comprehensive documentation

    • Medical surveillance for researchers

  • Alternative approaches:

    • Attenuated strains: Use F. tularensis subsp. holarctica 15 NIIEG vaccine strain, which has reduced virulence

    • Heterologous expression: Express and study F. tularensis YidC in E. coli or other BSL-1 compatible systems

    • Surrogate species: Work with closely related but less pathogenic F. philomiragia

    • Synthetic biology: Reconstruct minimal YidC systems using synthetic components

  • Genetic system considerations:

    • Plasmid selection: pGM∆recD suicide plasmid has been successfully used for genetic manipulation in F. tularensis

    • Transformation methods: Cryotransformation has proven effective for F. tularensis genetic manipulation

    • Selection systems: Chloramphenicol resistance and sucrose sensitivity (sacB) provide effective selection tools

  • Validation approaches:

    • Confirm findings from surrogate systems in authentic F. tularensis when required

    • Develop computational models to predict F. tularensis-specific effects

    • Use structural biology to validate functional conservation between models

The recD deletion approach demonstrated in F. tularensis subsp. holarctica research shows promise for creating safer research strains with reduced virulence while maintaining key biological properties . Similar approaches could be applied to create strains suitable for YidC research outside of BSL-3 facilities.

How does YidC contribute to F. tularensis host cell invasion and intracellular replication?

YidC's role in F. tularensis host cell invasion and intracellular replication is multifaceted:

  • Insertion of invasion-associated membrane proteins:

    • YidC facilitates integration of bacterial adhesins and invasins into the outer membrane

    • These proteins mediate initial attachment to host cell surfaces

    • Proper insertion and folding by YidC ensures optimal host receptor recognition

  • Phagosomal escape mechanisms:

    • F. tularensis alters phagosomal maturation and escapes into the cytosol

    • YidC likely inserts key membrane proteins involved in phagosomal membrane disruption

    • Francisella pathogenicity island (FPI) proteins that require membrane association for function depend on YidC for proper localization

  • Stress adaptation during intracellular lifecycle:

    • YidC inserts critical proteins involved in defense against reactive oxygen species

    • Peptide methionine sulfoxide reductases (MsrA and MsrB) require proper membrane localization and are upregulated during macrophage infection

    • These enzymes repair oxidation-damaged proteins, supporting bacterial survival

  • Nutrient acquisition systems:

    • YidC inserts membrane transporters necessary for nutrient acquisition within the nutrient-limited intracellular environment

    • Iron acquisition systems are particularly critical for intracellular replication

    • Siderophore receptors and other metal transporters likely depend on YidC for proper membrane integration

  • Evasion of host immune detection:

    • YidC-inserted membrane proteins modify bacterial surface structures to avoid recognition

    • Proper membrane protein organization helps mask pathogen-associated molecular patterns (PAMPs)

    • This evasion contributes to F. tularensis's ability to replicate extensively before triggering host responses

Experimental evidence from F. tularensis subsp. holarctica with modified genes shows significant changes in replication rates in J774.1A macrophage-like cells , suggesting membrane protein biogenesis plays a critical role in intracellular fitness. YidC's central function in this process makes it a key contributor to the bacterium's remarkable intracellular success.

What experimental systems best model the role of YidC during F. tularensis infection?

Multiple experimental systems can effectively model YidC's role during F. tularensis infection:

  • Cell culture infection models:

    • Primary macrophages: Derived from human or mouse blood/bone marrow

    • Macrophage cell lines: J774.1A cells have been successfully used to study F. tularensis replication

    • Dendritic cells: Primary targets of F. tularensis invasion

    • Measurement approaches: Gentamicin protection assays, fluorescence microscopy, electron microscopy

  • Conditional expression systems in infection models:

    • Tetracycline-regulated yidC expression: Allows controlled depletion during different infection stages

    • Temperature-sensitive YidC mutants: Enable rapid inactivation at specific infection timepoints

    • CRISPR interference: Provides tunable repression of yidC expression

  • Ex vivo tissue models:

    • Precision-cut lung slices: Maintain tissue architecture while allowing bacterial infection

    • 3D organoids: Recreate complex tissue environments

    • Flow systems: Model vascular infection dynamics

  • Animal infection models:

    • BALB/c mice: Standard model for F. tularensis virulence studies

    • Fischer 344 rats: Alternative model with different susceptibility profiles

    • Infection routes: Intradermal, intranasal, or intraperitoneal to model different exposure routes

  • Complementation approaches:

    • Heterologous YidC variants: Express YidC from different Francisella subspecies

    • Domain swaps: Replace specific YidC domains to identify infection-critical regions

    • Point mutations: Target conserved residues to disrupt specific functions

The selection of appropriate models should consider the specific aspect of infection being studied. For example, studying YidC's role in phagosomal escape requires cellular models with intact endocytic pathways, while investigating systemic spread necessitates animal models. The reduced virulence observed in gene-modified F. tularensis strains in mouse models demonstrates the utility of animal systems for evaluating the contribution of specific proteins to pathogenesis.

How might inhibition of YidC function affect F. tularensis virulence in therapeutic contexts?

Inhibition of YidC function presents a promising therapeutic approach with multiple potential impacts on F. tularensis virulence:

  • Primary virulence impacts:

    • Membrane integrity disruption: YidC inhibition would compromise bacterial membrane composition

    • Virulence factor reduction: Decreased insertion of critical virulence proteins

    • Stress adaptation impairment: Reduced ability to respond to host defense mechanisms

    • Growth inhibition: Similar to effects observed in recD mutant strains, showing reduced growth in vitro and in vivo

  • Specific therapeutic advantages:

    • Novel target class: YidC represents an underexploited antibacterial target

    • Essential function: YidC is likely essential for bacterial viability, making resistance development more difficult

    • Broad application: Could be effective against multiple Francisella subspecies, including highly virulent F. tularensis subsp. tularensis

    • Synergistic potential: Could enhance effectiveness of existing antibiotics by compromising membrane barrier function

  • Therapeutic delivery strategies:

    • Liposomal formulations: Enhance delivery to infected macrophages

    • Antimicrobial peptides: Target the YidC-substrate interface

    • Small molecule inhibitors: Block critical YidC functional domains

    • Nucleic acid-based approaches: Antisense or CRISPR-based inhibition of yidC expression

  • Potential therapeutic limitations:

    • Access challenges: Inhibitors must reach intracellular bacteria

    • Selectivity requirements: Need to distinguish bacterial YidC from human OXA1

    • Resistance mechanisms: Potential compensatory mutations in alternative insertion pathways

    • Biofilm considerations: Established biofilms may provide protection against YidC inhibitors

  • Clinical relevance:

    • Treatment of antibiotic-resistant infections: Alternative for difficult-to-treat cases

    • Biodefense applications: Countermeasure against potential bioterrorism agents

    • Combination therapy: Use alongside conventional antibiotics to enhance efficacy and reduce resistance development

The observed 60% mortality rate in untreated F. tularensis subsp. tularensis infections underscores the urgent need for novel therapeutic approaches. YidC inhibition represents a promising strategy, particularly given the reduced virulence observed in F. tularensis strains with other gene modifications and the essential nature of membrane protein biogenesis for bacterial survival.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.