Recombinant Francisella tularensis subsp. tularensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant nuoK protein is produced via heterologous expression in E. coli, with subsequent purification using affinity chromatography (via His-tag). Key production parameters include:

ParameterDetailsSource
Storage BufferTris-based buffer + 50% glycerol
Storage Conditions-20°C or -80°C for long-term
StabilityAvoid repeated freeze-thaw cycles

The protein is typically sold as a lyophilized powder or in solution, optimized for biochemical assays or antibody-based detection methods like ELISA .

Role in Francisella tularensis Pathogenicity

Genetic Context:

  • Core Genome Consistency: nuoK is part of the conserved core genome, with high sequence similarity across F. tularensis subspecies .

  • FPI Redundancy: The FPI, duplicated in F. tularensis subspecies, encodes virulence factors (e.g., IglC, PdpA) but not nuoK .

Research Applications

Recombinant nuoK is primarily used in:

  1. ELISA Kits: For detecting anti-F. tularensis antibodies in serological studies .

  2. Biochemical Studies: To characterize enzyme kinetics, inhibitor binding, or interactions with other Complex I subunits .

Limitations in Current Research

  • Direct Virulence Studies: No evidence links nuoK to pathogenicity mechanisms like phagosomal escape or host immune evasion .

  • Antibiotic Targeting: While Complex I inhibitors (e.g., benzoxazoles) show promise against F. tularensis, nuoK-specific inhibitors remain unexplored .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery times, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, and for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; FTF0041; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain FSC 198)
Target Names
nuoK
Target Protein Sequence
MRALKMNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSIELMLLAVNTNFLIFA NMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSKLNTLRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone. It couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Database Links

KEGG: ftf:FTF0041

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NADH-quinone oxidoreductase subunit K in Francisella tularensis?

NADH-quinone oxidoreductase subunit K (nuoK) is a small, integral membrane protein component of the NADH dehydrogenase I complex (NDH-1) in Francisella tularensis. It consists of 110 amino acids with the sequence MRALKMNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSIELMLLAVNTNFLIFANMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSKLNTLRG . The protein functions within the respiratory chain, participating in electron transport and energy metabolism. As part of the NDH-1 complex, nuoK contributes to the transfer of electrons from NADH to quinones in the bacterial membrane, coupled with proton translocation across the membrane to generate the proton motive force needed for ATP synthesis.

What is the genetic context of nuoK in the Francisella tularensis genome?

The nuoK gene is part of the nuo operon in Francisella tularensis, designated as FTT_0041 in the SCHU S4 strain and FTF0041 in the FSC 198 strain . It is typically flanked by other nuo genes in the genomic arrangement: nuoH, nuoI, nuoJ, nuoK, nuoL, nuoM, and nuoN . This genomic organization reflects the structural organization of the NDH-1 complex, where these proteins interact physically. When designing experiments targeting nuoK, researchers should consider the potential polar effects on downstream genes if conducting genetic manipulations, as disruption of nuoK may affect expression of other components within this operon.

What are the optimal conditions for expressing recombinant F. tularensis nuoK protein?

Expressing recombinant membrane proteins like nuoK presents significant challenges due to their hydrophobic nature. Based on available research protocols, the expression of full-length nuoK (amino acids 1-110) requires careful optimization . For bacterial expression systems, consideration should be given to using specialized E. coli strains designed for membrane protein expression (such as C41/C43) with controlled induction conditions (typically lower IPTG concentrations and reduced temperatures of 18-25°C). Addition of solubilizing agents or fusion tags (such as maltose-binding protein or thioredoxin) can improve solubility. For mammalian or insect cell expression systems, codon optimization and the inclusion of appropriate signal sequences are recommended for proper membrane insertion.

How should researchers design experiments to study the role of nuoK in F. tularensis pathogenesis?

When investigating nuoK's role in pathogenesis, a multifaceted approach is recommended:

  • Genetic manipulation: Create precise deletion mutants or conditional expression strains of nuoK using allelic exchange techniques appropriate for Francisella.

  • Phenotypic characterization: Assess growth in different media and under various stress conditions relevant to the host environment (oxidative stress, iron limitation, acidic pH) .

  • Infection models: Evaluate the ΔnuoK mutant's ability to invade, survive, and replicate within macrophages compared to wild-type strains.

  • In vivo studies: Determine virulence attenuation in appropriate animal models.

  • Complementation: Perform genetic complementation to confirm phenotypes are specifically due to nuoK loss.

Researchers should note that F. tularensis is a highly infectious pathogen requiring appropriate biosafety containment (BSL-3 for virulent strains), and should design experiments accordingly .

What methods are recommended for analyzing nuoK protein-protein interactions within the respiratory complex?

To study nuoK protein-protein interactions within the NDH-1 complex, researchers can employ several complementary approaches:

  • Co-immunoprecipitation: Using antibodies against nuoK or an epitope tag to pull down interacting partners.

  • Bacterial two-hybrid systems: Particularly those optimized for membrane protein interactions.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify proximity relationships.

  • Blue native PAGE: To preserve native protein complexes containing nuoK.

  • Cryo-electron microscopy: For structural analysis of the entire respiratory complex.

When interpreting results, researchers should consider that nuoK interactions may be transient or dependent on the membrane environment. Detergent choice is critical when extracting membrane proteins, as harsh detergents may disrupt native interactions. Validation using multiple approaches is strongly recommended to confirm genuine interactions.

What are the optimal storage conditions for recombinant nuoK protein?

Recombinant nuoK protein should be stored at -20°C for regular use, with long-term storage at -20°C or -80°C in an appropriate buffer containing 50% glycerol . The recommended storage buffer is Tris-based and optimized for protein stability. To maintain protein integrity, avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and aggregation. Working aliquots can be stored at 4°C for up to one week . For experiments requiring frequent use, preparing multiple small-volume aliquots is recommended to minimize freeze-thaw cycles and preserve protein activity.

How can researchers verify the functional integrity of purified recombinant nuoK?

Given nuoK's role in the NADH dehydrogenase complex, functional integrity can be assessed through:

  • Spectrophotometric activity assays: Measuring NADH oxidation rates when incorporated into artificial membrane systems.

  • Circular dichroism: To verify proper secondary structure, particularly important for alpha-helical membrane proteins.

  • Size exclusion chromatography: To confirm proper oligomeric state and absence of aggregation.

  • Reconstitution experiments: Measuring the ability of nuoK to complement activity in NDH-1 complex depleted of this subunit.

  • Thermal shift assays: To assess protein stability under various conditions.

Researchers should establish baseline activity parameters for their specific protein preparation and experimental system, as functional characteristics may vary between different expression and purification protocols.

How does nuoK contribute to F. tularensis metabolic adaptation during infection?

NADH-quinone oxidoreductase subunit K plays a critical role in F. tularensis bioenergetics during infection. As part of the NDH-1 complex, it contributes to respiratory flexibility, allowing the bacterium to adapt to varying oxygen and nutrient availability within host cells. Research suggests that during intracellular growth, F. tularensis modulates its respiratory chain components, including the NDH-1 complex containing nuoK, to optimize energy production while minimizing production of reactive oxygen species .

When designing experiments to investigate this adaptation, researchers should consider:

  • Comparative transcriptomics/proteomics of F. tularensis under different growth conditions (e.g., iron limitation, oxidative stress) .

  • Real-time monitoring of bacterial bioenergetics during macrophage infection.

  • Assessment of ΔnuoK mutant fitness under various stress conditions relevant to the host environment.

  • Correlation between respiratory chain activity and virulence phenotypes.

Understanding nuoK's contribution to metabolic adaptation may reveal vulnerabilities that could be targeted for therapeutic development.

How can researchers utilize recombinant nuoK in vaccine development against F. tularensis?

Leveraging recombinant nuoK for vaccine development requires understanding its immunogenicity and protective potential:

  • Epitope mapping: Identify immunodominant regions within nuoK using bioinformatics and experimental validation.

  • Immunization studies: Evaluate recombinant nuoK alone or in combination with other F. tularensis proteins as subunit vaccines .

  • Adjuvant optimization: Test various adjuvant formulations to enhance immune responses against nuoK.

  • Correlates of protection: Determine whether anti-nuoK antibodies or T-cell responses correlate with protection.

  • Cross-protection: Assess whether immunity against nuoK provides protection against different F. tularensis subspecies.

Researchers should note that while nuoK may not be among the most abundant exported proteins identified in previous studies , its membrane location could make it accessible to the immune system during certain stages of infection. Combinatorial approaches including nuoK with other immunogenic proteins may yield more robust protection than single-antigen approaches.

What are the methodological considerations for studying nuoK in the context of antimicrobial development?

When investigating nuoK as a potential antimicrobial target, researchers should consider:

  • Target validation: Confirm essentiality of nuoK through conditional knockdown systems rather than complete gene deletion if the latter is lethal.

  • Assay development: Establish high-throughput screening assays specific for nuoK function within the NDH-1 complex.

  • Structure-based drug design: Utilize homology modeling based on related bacterial NDH-1 structures if direct structural information is unavailable.

  • Selectivity profiling: Ensure potential inhibitors target bacterial nuoK with minimal effects on human mitochondrial homologs.

  • Permeability considerations: Address challenges in delivering inhibitors across both the bacterial membrane and the host cell membrane to reach intracellular bacteria.

A comparative analysis table of potential targeting strategies would include:

Targeting StrategyAdvantagesChallengesValidation Methods
Direct enzyme inhibitionSpecific mechanism of actionRequires detailed structural knowledgeEnzyme activity assays, growth inhibition studies
Protein-protein interaction disruptionNovel mechanism potentially less prone to resistanceDifficult to achieve specificityFRET-based interaction assays, bacterial two-hybrid validation
Allosteric modulationMay offer improved selectivityComplex structure-activity relationshipsMolecular dynamics simulations, hydrogen-deuterium exchange mass spectrometry
Antisense/RNA interferenceHigh specificityDelivery challenges in Gram-negative bacteriaqRT-PCR, conditional expression systems

How does nuoK function within the context of F. tularensis adaptation to iron limitation?

Iron limitation is a key stress encountered by F. tularensis during infection as part of nutritional immunity. While nuoK itself is not directly involved in iron acquisition, the NDH-1 complex's function may be modulated during iron starvation as part of a coordinated metabolic response. Microarray studies have shown that F. novicida (closely related to F. tularensis) undergoes significant transcriptional changes under iron-limited conditions, including alterations in energy metabolism pathways .

Researchers investigating nuoK in the context of iron limitation should:

  • Examine transcriptional/translational changes in the nuo operon during iron starvation.

  • Analyze the impact of iron limitation on NDH-1 complex assembly and function.

  • Investigate potential interactions between iron-sulfur cluster biogenesis pathways and NDH-1 complex functionality.

  • Consider the relationship between respiratory chain activity and production of reactive oxygen species under iron-limited conditions.

The complex interplay between iron availability, energy metabolism, and virulence makes this a particularly rich area for systems biology approaches.

What comparative genomic insights can be gained from studying nuoK across different Francisella species and strains?

Comparative genomic analysis of nuoK across Francisella species can provide insights into evolutionary adaptation and functional conservation:

  • Sequence conservation: The high conservation of nuoK across Francisella strains suggests essential functionality .

  • Structural predictions: Comparative analysis can inform structure-function relationships in nuoK.

  • Co-evolution patterns: Identifying co-evolving residues within nuoK or between nuoK and other Nuo subunits can reveal functional interactions.

  • Subspecies differences: Subtle variations in nuoK between subspecies may contribute to differences in metabolic efficiency and virulence .

When conducting such analyses, researchers should utilize whole-genome sequences of multiple Francisella strains, including F. tularensis subsp. tularensis, F. tularensis subsp. holarctica, and F. novicida. Phylogenetic approaches should be combined with functional predictions to generate testable hypotheses about nuoK's role in Francisella biology and pathogenesis.

What strategies can researchers employ when facing difficulties in recombinant nuoK expression and purification?

Membrane proteins like nuoK present significant challenges in recombinant expression and purification. When encountering difficulties, consider these troubleshooting approaches:

  • Expression system optimization:

    • Try different E. coli strains specifically designed for membrane proteins (C41/C43, Lemo21).

    • Test various induction conditions (temperature, inducer concentration, duration).

    • Consider cell-free expression systems that can accommodate membrane proteins.

  • Solubilization strategies:

    • Screen multiple detergents (DDM, LDAO, Brij-35) for optimal extraction efficiency.

    • Test detergent-lipid mixtures to maintain native-like environment.

    • Consider amphipol or nanodisc technologies for stabilization after purification.

  • Fusion constructs:

    • Add solubility-enhancing tags (MBP, GST, SUMO).

    • Include purification tags that perform well with membrane proteins (His10 instead of His6).

    • Test different tag positions (N-terminal vs. C-terminal).

  • Expression verification:

    • Use Western blotting with tag-specific antibodies if protein expression seems low.

    • Check for toxic effects on host cells that might limit expression.

Remember that storage conditions are critical; recombinant nuoK should be stored with 50% glycerol at -20°C or -80°C to maintain stability .

How can researchers address data inconsistencies when studying nuoK function in different experimental models?

When facing inconsistent results across different experimental systems, implement these systematic approaches:

  • Standardization protocols:

    • Establish consistent growth conditions and media compositions.

    • Standardize protein concentrations and activity measurements.

    • Use internal controls appropriate for each experimental system.

  • Strain validation:

    • Confirm genetic integrity of bacterial strains through sequencing.

    • Verify phenotypes with complementation experiments.

    • Use multiple independent clones to rule out secondary mutations.

  • Technical considerations:

    • Evaluate effects of different buffer compositions on protein activity.

    • Consider the impact of different detergents on protein conformation and function.

    • Assess whether tags or fusion partners affect protein behavior differently across systems.

  • Contextual factors:

    • Determine if protein function is affected by bacterial growth phase.

    • Consider host cell type variations if working with infection models.

    • Evaluate the impact of environmental factors (pH, temperature, oxygen levels).

Creating a systematic matrix of variables to test methodically can help identify sources of inconsistency and establish robust, reproducible experimental conditions.

What emerging technologies might advance our understanding of nuoK's role in F. tularensis pathogenesis?

Several cutting-edge technologies hold promise for elucidating nuoK's functions:

These approaches, combined with traditional biochemical and genetic methods, could provide unprecedented insights into nuoK's role in F. tularensis pathogenesis and identify new therapeutic targets within the respiratory complex.

How might nuoK research contribute to broader understanding of bacterial respiratory complexes?

Research on F. tularensis nuoK has implications beyond this specific pathogen:

  • Comparative analysis with respiratory complexes from other intracellular pathogens could reveal common adaptation strategies.

  • Insights into membrane protein assembly and function in extremophilic bacteria (given F. tularensis' ability to survive in harsh environments).

  • Understanding bacterial respiratory chain plasticity during host adaptation.

  • Development of new model systems for studying membrane protein complexes in Gram-negative bacteria.

As research progresses, findings related to nuoK structure, function, and regulation may contribute to fundamental knowledge about bacterial bioenergetics and host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.