Recombinant Francisella tularensis subsp. tularensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Genetic Essentiality and Pathway Interactions

Global essentiality screens in F. tularensis Schu S4 highlight lgt as a non-redundant component of the lipoprotein biosynthesis pathway. Key findings include:

PropertyDetailsReferences
Gene essentialityNo transposon insertions detected in lgt across saturation mutagenesis.
Metabolic pathway roleIntegrally linked to peptidoglycan synthesis and outer membrane integrity.
Interaction with Lol systemWorks with modified LolABC transporters to sort lipoproteins, even if diacylated.

These data underscore Lgt’s indispensability in maintaining cell envelope stability and stress resistance .

Therapeutic and Diagnostic Relevance

Lgt is a promising antimicrobial target due to its essential role and absence in humans:

  • Antibiotic susceptibility: Depletion of Lgt increases outer membrane permeability, sensitizing bacteria to rifampin and β-lactams .

  • Vaccine development: Glycoconjugate vaccines using F. tularensis O-antigen linked to carrier proteins (e.g., Pseudomonas exotoxin A) rely on functional lipoprotein pathways .

  • Diagnostic tools: Outer membrane lipoproteins like FopA are immunogenic biomarkers; Lgt’s role in their biogenesis supports diagnostic assay development .

Comparative Analysis with Other Bacteria

FeatureF. tularensis LgtE. coli Lgt
EssentialityEssential for growth and virulence.Essential; depletion causes cell lysis.
Lipoprotein sortingTolerates diacylated lipoproteins in OM.Requires triacylation for proper sorting.
Inhibitor susceptibilityNot yet tested.Potently inhibited by compounds (IC<sub>50</sub> ~0.18–0.93 μM).
Genetic manipulationChallenging due to pathogenicity constraints.Amenable to high-throughput mutagenesis.

Research Gaps and Future Directions

  • Structural characterization: No crystal structures exist for F. tularensis Lgt, limiting drug design efforts.

  • Host-pathogen interactions: How Lgt-dependent lipoproteins modulate immune evasion remains unclear.

  • Species-specific adaptations: The evolutionary basis for relaxed essentiality of downstream enzymes (e.g., Lnt) in F. tularensis warrants study .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with your specified tag.
Synonyms
lgt; FTW_0718; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Francisella tularensis subsp. tularensis (strain WY96-3418)
Target Names
lgt
Target Protein Sequence
MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFY VALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFIGVLIAFALFARKIGAN FFDLGEFVAPVIPIGLGAGRIGNFINGELWGKVTDSPLGMVFPTGGPLPRYPSQLFEFFF EGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGCARFICEFFRQPDPQYGYIFFNWMTMGQI LSIPMILLGAVILIAVFIKTRKNKCENI
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: ftw:FTW_0718

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Lgt in F. tularensis?

Lgt (prolipoprotein diacylglyceryl transferase) catalyzes the first critical step in bacterial lipoprotein biosynthesis by transferring a diacylglyceryl group from phosphatidylglycerol to prolipoproteins. In F. tularensis, this enzyme plays an essential role in the post-translational modification pathway of lipoproteins that contribute to bacterial envelope integrity and virulence. The process involves the addition of a diacylglyceryl group to the sulfhydryl side chain of the invariant Cys+1 residue in prolipoproteins as they exit the transport machinery after being secreted via the Sec or Tat translocon .

Where is Lgt localized in F. tularensis cells?

Lgt is an integral membrane protein located in the inner membrane of F. tularensis. Based on structural studies of Lgt from other gram-negative bacteria like E. coli, the enzyme is embedded in the membrane by seven transmembrane segments, with its N-terminus facing the periplasm and its C-terminus facing the cytoplasm. This topology positions the enzyme to interact with prolipoproteins as they exit the Sec or Tat translocon .

How does F. tularensis Lgt structure compare with Lgt from other bacteria?

F. tularensis Lgt shares the characteristic "Lgt signature motif" found in Lgt enzymes across both Gram-negative and Gram-positive bacteria. This highly conserved region contains invariant residues essential for enzymatic function. While the specific crystal structure of F. tularensis Lgt has not been fully characterized, studies on E. coli Lgt reveal the presence of two binding sites that accommodate the phosphatidylglycerol substrate and the prolipoprotein acceptor. The conserved residues such as R143, R239, Y26, N146, and G154 play critical roles in catalysis and are likely preserved in the F. tularensis enzyme .

What expression systems are optimal for producing recombinant F. tularensis Lgt?

The most widely used expression system for recombinant F. tularensis Lgt is E. coli. Several studies have successfully employed in vitro E. coli expression systems to produce functional Lgt protein for biochemical and structural analyses. When expressing the full-length protein (268 amino acids for F. tularensis subsp. holarctica Lgt), researchers typically use E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3). The recombinant protein is often tagged with an N-terminal His-tag (10xHis-tag) to facilitate purification .

For expression, researchers should consider:

  • Using vectors with tunable promoters (like pET series) to control expression levels

  • Growing cultures at lower temperatures (16-25°C) after induction to improve proper folding

  • Supplementing media with appropriate cofactors or lipids that might enhance proper folding

What are the most effective methods for purifying recombinant F. tularensis Lgt?

Purification of recombinant F. tularensis Lgt requires specialized approaches due to its integral membrane nature. A methodological workflow includes:

  • Membrane fraction isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions

  • Detergent solubilization: Using mild detergents (DDM, LDAO, or C12E8) to extract Lgt from membranes

  • Affinity chromatography: Utilizing the His-tag for IMAC purification (Ni-NTA or TALON resin)

  • Size-exclusion chromatography: Further purification to remove aggregates and ensure monodispersity

For optimal storage, the purified protein should be maintained in a buffer containing Tris/PBS (pH 8.0) with 6% trehalose as a stabilizing agent. Aliquoting and storage at -80°C is recommended to prevent freeze-thaw cycles that could compromise protein integrity .

What biochemical assays can be used to measure recombinant F. tularensis Lgt activity?

Several biochemical assays have been developed to measure the enzymatic activity of recombinant Lgt:

  • Glycerol phosphate release assay: Measures the release of glycerol phosphate (a by-product of the Lgt-catalyzed reaction) using a coupled luciferase reaction. When Lgt transfers the diacylglyceryl group from phosphatidylglycerol to a peptide substrate, glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) is released depending on the substrate used .

  • Radiolabeled lipid incorporation: Uses [14C]-palmitic acid to track lipid transfer to prolipoproteins. The radiolabeled products can be separated by SDS-PAGE and visualized by autoradiography. Functional Lgt will incorporate the radiolabeled lipids into proteins, which can be observed as distinct bands on autoradiographs .

  • Fluorescent peptide substrate assay: Utilizes a fluorescently labeled peptide derived from bacterial lipoproteins (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt) that can be monitored for changes in fluorescence properties upon lipid modification .

What are the critical residues in F. tularensis Lgt and how do they affect enzyme function?

Based on studies of Lgt from various bacterial species including E. coli, several critical residues likely play important roles in F. tularensis Lgt function:

ResidueFunctionEffect of Mutation
Y26Absolutely required for catalytic activityComplete loss of function when mutated to alanine
His103Acts as catalytic base to abstract proton from cysteineSignificant reduction in catalytic efficiency
R143Stabilizes glycerol-1-phosphate head groupEssential for diacylglyceryl transfer
N146Critical for catalytic functionComplete loss of function when mutated to alanine
E151Important for enzymatic activitySignificant reduction in function when mutated
G154Absolutely required for Lgt functionComplete loss of function when mutated to alanine
R236Acts as a gatekeeper for substrate binding/product releaseAffects loop opening and catalytic efficiency
R239Stabilizes glycerol-1-phosphate head groupEssential for diacylglyceryl transfer
E243Important for enzymatic activitySignificant reduction in function when mutated

Mutagenesis studies in E. coli have demonstrated that residues Y26, N146, and G154 are absolutely required for Lgt function, while R143, E151, R239, and E243 are important but not strictly essential .

How does substrate specificity of F. tularensis Lgt compare to other bacterial Lgt enzymes?

F. tularensis Lgt exhibits broad substrate specificity similar to other bacterial Lgt enzymes, accommodating various prolipoproteins with a conserved "lipobox" motif. The lipobox typically consists of [LVI][ASTVI][GAS]C, where C is the invariant cysteine that undergoes lipid modification.

For the lipid substrate, Lgt preferentially utilizes phosphatidylglycerol but can also accept other phospholipids at varying efficiencies. While the detailed substrate preference of F. tularensis Lgt has not been extensively characterized, studies with E. coli Lgt suggest that the acyl chain length and saturation of the phospholipid substrate can influence enzyme activity.

QM/MM calculations and structural studies indicate that Lgt has two main binding sites:

  • A phospholipid binding site that accommodates the phosphatidylglycerol substrate

  • A peptide binding site that recognizes the lipobox motif of prolipoproteins

The opening of the L6-7 loop, mediated by the conserved R236 residue, facilitates the release of modified lipoprotein products and entry of new phosphatidylglycerol substrates .

What phenotypes are associated with lgt mutants or Lgt inhibition in Francisella and related bacteria?

Studies on lgt mutants or Lgt-depleted strains in various bacterial species reveal several phenotypes that are likely relevant to F. tularensis:

  • Envelope defects: Lgt depletion leads to permeabilization of the outer membrane, compromising bacterial integrity and increasing susceptibility to environmental stresses .

  • Serum sensitivity: Bacteria lacking functional Lgt show increased sensitivity to serum killing due to compromised envelope integrity .

  • Antibiotic susceptibility: Lgt-depleted strains exhibit increased sensitivity to antibiotics, particularly those targeting cell envelope processes .

  • Impaired germination: In spore-forming bacteria like B. anthracis, lgt mutant spores germinate inefficiently both in vitro and in vivo .

  • Attenuated virulence: In animal infection models, bacteria with lgt mutations show reduced virulence compared to wild-type strains .

  • Altered inflammatory responses: Lgt mutations can reduce TLR2-dependent TNF-α responses in macrophages exposed to the bacteria, affecting host-pathogen interactions .

These phenotypes highlight the potential of Lgt as an antimicrobial target and underscore its importance in bacterial physiology and pathogenesis.

How can researchers generate and validate lgt mutants in F. tularensis?

Generating lgt mutants in F. tularensis requires careful consideration due to the essential nature of this gene in many bacteria. A comprehensive approach includes:

  • Conditional mutant construction:

    • Create an inducible lgt depletion strain using tetracycline-responsive or similar systems

    • Integrate a second copy of lgt under an inducible promoter before deleting the native gene

    • Use the "suicide vector" approach with homologous recombination to create clean deletions

  • Mutagenesis strategy:

    • Design primers to amplify approximately 1500 bp regions upstream and downstream of lgt

    • Clone these fragments into a vector like pGEM-T Easy

    • Join the upstream and downstream regions, omitting the central region of lgt

    • Transfer this construct to a suitable suicide vector (e.g., pPV for F. tularensis)

    • Introduce the construct via conjugation or electroporation

  • Validation methods:

    • PCR verification of the deletion

    • RT-qPCR to confirm absence of lgt transcription

    • Western blotting to detect accumulation of unprocessed prolipoproteins

    • [14C]-palmitic acid labeling to confirm absence of lipid modification on proteins

What are the most effective approaches for studying Lgt inhibition in F. tularensis?

Several approaches can be employed to study Lgt inhibition in F. tularensis:

  • Small molecule inhibitor screening:

    • Develop in vitro biochemical assays using recombinant Lgt to screen compound libraries

    • Monitor inhibition by measuring glycerol phosphate release or disruption of lipid transfer

    • Validate hits using orthogonal assays (e.g., [14C]-palmitic acid labeling)

    • Assess membrane permeability and growth inhibition in whole cells

  • Target validation:

    • Compare phenotypes of chemical inhibition with genetic depletion/deletion

    • Examine accumulation of unmodified prolipoproteins by Western blot

    • Analyze changes in membrane integrity and function

    • Test for cross-resistance with other antimicrobial agents

  • Structure-activity relationship (SAR) studies:

    • Synthesize analogs of identified inhibitors

    • Correlate structural modifications with changes in potency

    • Use computational docking to predict binding modes

    • Validate binding predictions with site-directed mutagenesis of key residues

  • Resistance development:

    • Generate resistant mutants through serial passage in sub-inhibitory concentrations

    • Sequence resistant strains to identify potential resistance mechanisms

    • Characterize cross-resistance patterns to other antimicrobials

What cell-free systems can be developed to study the enzymatic mechanism of F. tularensis Lgt?

Researchers can develop sophisticated cell-free systems to study F. tularensis Lgt enzymatic mechanisms:

  • Reconstituted proteoliposomes:

    • Purify recombinant Lgt and incorporate it into synthetic liposomes

    • Include defined phospholipid compositions mimicking the bacterial inner membrane

    • Add synthetic peptide substrates containing the lipobox motif

    • Monitor lipid transfer using fluorescent or radiolabeled substrates

  • Coupled enzyme systems:

    • Develop assays where Lgt activity is linked to easily measurable enzymatic reactions

    • Use glycerol-3-phosphate dehydrogenase to convert released G3P to measurable products

    • Employ luciferase-based detection systems for enhanced sensitivity

  • QM/MM computational approaches:

    • Construct molecular models of F. tularensis Lgt based on available structures

    • Simulate the catalytic mechanism using quantum mechanics/molecular mechanics

    • Investigate roles of critical residues like His103, Arg143, and Arg239

    • Model enzyme-substrate interactions and transitions states

  • Single-molecule studies:

    • Develop FRET-based assays with labeled substrates and enzyme

    • Monitor real-time conformational changes during catalysis

    • Study kinetics of substrate binding and product release

    • Investigate the effects of inhibitors on enzyme dynamics

How can recombinant F. tularensis Lgt be utilized for developing novel diagnostics?

Recombinant F. tularensis Lgt offers several opportunities for diagnostic applications:

  • Antibody development:

    • Generate anti-Lgt antibodies for immunoassay development

    • Develop sandwich ELISA or lateral flow assays using these antibodies

    • Create multiplexed assays targeting multiple F. tularensis proteins including Lgt

  • Enzyme-based biosensors:

    • Engineer biosensors that detect Lgt activity in biological samples

    • Develop fluorescent or colorimetric substrates that change properties upon modification by Lgt

    • Create microfluidic devices incorporating these detection systems

  • Inhibitor-based diagnostics:

    • Design probes that selectively bind to F. tularensis Lgt

    • Develop competitive binding assays using labeled inhibitors

    • Create diagnostic kits for field detection of F. tularensis based on Lgt inhibition

While Lgt itself may not be the optimal target for F. tularensis diagnostics compared to surface antigens like FopA (which can be detected at concentrations as low as 0.3 ng/mL in various matrices), recombinant Lgt can be used as a control antigen in diagnostic assay development and validation .

What is the potential of F. tularensis Lgt as a target for novel antimicrobial development?

F. tularensis Lgt represents a promising target for antimicrobial development for several reasons:

  • Essential function: Lgt is required for proper lipoprotein processing, which is essential for bacterial envelope integrity and function in most bacteria.

  • Unique mechanism: The diacylglyceryl transferase activity of Lgt has no human homolog, reducing the risk of off-target effects.

  • Conserved active site: The catalytic site contains highly conserved residues that are essential for function, providing a well-defined target for inhibitor design.

  • Resistance considerations: Unlike inhibitors of later steps in lipoprotein biosynthesis, resistance to Lgt inhibitors may be less likely to develop through simple gene deletion, as demonstrated in studies with E. coli .

Recent research has identified the first Lgt inhibitors that potently inhibit E. coli Lgt biochemical activity (IC50 values of 0.18-0.93 μM) and show bactericidal activity against wild-type E. coli and Acinetobacter baumannii. These compounds could serve as starting points for developing F. tularensis-specific inhibitors .

Potential development strategies include:

  • Structure-based design targeting the conserved Lgt active site

  • Phosphatidylglycerol mimetics that competitively inhibit substrate binding

  • Allosteric inhibitors that prevent conformational changes required for catalysis

  • Covalent inhibitors targeting essential catalytic residues

How might recombinant F. tularensis Lgt contribute to vaccine development strategies?

Recombinant F. tularensis Lgt can contribute to vaccine development in several ways:

  • Subunit vaccine component:

    • Lgt itself could be included in multicomponent subunit vaccines

    • Properly folded recombinant Lgt might elicit antibodies that interfere with lipoprotein processing

  • Adjuvant development:

    • Modified Lgt could serve as a carrier protein for F. tularensis antigens

    • Enzymatically inactive Lgt variants could be used to present lipidated antigens with enhanced immunogenicity

  • Lipidated antigen production:

    • Functional recombinant Lgt could be used to produce lipidated antigens in vitro

    • These lipidated proteins often demonstrate enhanced immunogenicity compared to non-lipidated counterparts

  • Live attenuated vaccine design:

    • Partial attenuation of Lgt function could contribute to rationally designed live attenuated vaccines

    • Combining Lgt modifications with other attenuating mutations might achieve the right balance of safety and immunogenicity

Studies have shown that immunization with F. tularensis proteins can induce protective immunity in animal models. While Lgt itself may not be the most immunodominant antigen, its proper function is likely essential for the correct presentation of other immunogenic lipoproteins on the bacterial surface .

How do post-translational modifications of Lgt affect its function in F. tularensis?

The role of post-translational modifications (PTMs) in regulating F. tularensis Lgt remains largely unexplored, presenting an important frontier for research. Potential PTMs that might affect Lgt function include:

  • Phosphorylation: Serine, threonine, or tyrosine residues in cytoplasmic loops or the C-terminal domain could be phosphorylated, potentially regulating enzyme activity or substrate binding.

  • S-nitrosylation: Cysteine residues might undergo S-nitrosylation in response to nitrosative stress during infection, potentially modulating enzyme activity.

  • Oxidation/reduction: Redox-sensitive residues could respond to changes in the bacterial redox environment, providing a mechanism to regulate Lgt activity in different host compartments.

Methodological approaches to study these modifications include:

  • Mass spectrometry-based proteomic analysis of Lgt under different growth conditions

  • Site-directed mutagenesis of potential modification sites

  • Activity assays comparing Lgt from different growth phases or stress conditions

  • In vitro modification of purified Lgt to assess functional consequences

What is the role of Lgt in F. tularensis adaptation to different host environments?

F. tularensis encounters diverse environments during infection, from extracellular spaces to various intracellular compartments. Lgt likely plays a role in adaptation to these changing conditions:

  • Intracellular adaptation:

    • Lgt-mediated lipoprotein processing may be regulated differently within macrophages

    • Changes in phospholipid availability or composition inside host cells could affect Lgt substrate preferences

    • Host-derived antimicrobial compounds might target or modulate Lgt activity

  • Environmental sensing:

    • Lgt-processed lipoproteins may function as sensors for environmental changes

    • Alterations in Lgt activity could affect the composition of the bacterial envelope in response to host conditions

  • Temporal regulation:

    • Lgt activity might be differentially regulated during different stages of infection

    • Early vs. late infection phases might require different patterns of lipoprotein modification

Research approaches to explore these questions include:

  • Transcriptomic and proteomic analysis of Lgt expression and activity during infection

  • Comparison of lipoprotein profiles from bacteria isolated from different host compartments

  • Development of reporter systems to monitor Lgt activity in real-time during infection

  • Conditional Lgt depletion at different stages of infection to assess stage-specific requirements

How does the interaction between Lgt and other lipoprotein processing enzymes (LspA, Lnt) affect F. tularensis virulence?

The lipoprotein processing pathway in bacteria involves three sequential enzymes: Lgt, LspA (lipoprotein signal peptidase), and Lnt (apolipoprotein N-acyltransferase). The coordination between these enzymes is critical but poorly understood in F. tularensis:

Research methodologies to investigate these interactions include:

  • Co-immunoprecipitation and cross-linking studies to detect physical interactions

  • Fluorescence microscopy to assess co-localization in the membrane

  • Pulse-chase experiments to track the kinetics of sequential processing

  • Construction of strains with altered stoichiometry of processing enzymes to identify bottlenecks

  • Comparative studies with other bacterial species where all three enzymes are essential

Understanding these interactions could reveal unique aspects of F. tularensis biology and identify potential vulnerabilities for therapeutic targeting.

What are the current gaps in our understanding of F. tularensis Lgt function?

Despite progress in understanding Lgt function in various bacteria, several knowledge gaps remain specific to F. tularensis Lgt:

  • Structural information: No crystal structure of F. tularensis Lgt is currently available, limiting structure-based approaches to inhibitor design.

  • Substrate specificity: The preference for specific prolipoproteins and lipid donors in F. tularensis has not been comprehensively characterized.

  • Regulation mechanisms: How Lgt expression and activity are regulated in response to changing environments during infection remains poorly understood.

  • Essential nature: While Lgt is essential in many bacteria, confirmation of its essentiality in F. tularensis and determination of whether bypass mechanisms exist is needed.

  • Subspecies differences: Potential functional differences in Lgt between the more virulent F. tularensis subsp. tularensis and less virulent subspecies have not been explored.

What emerging technologies could advance our understanding of F. tularensis Lgt?

Several cutting-edge technologies hold promise for advancing Lgt research:

How might interdisciplinary approaches enhance F. tularensis Lgt research and applications?

The most promising advances in F. tularensis Lgt research will likely come from interdisciplinary collaborations:

  • Structural biology and computational chemistry: Integration of these fields could accelerate inhibitor design through detailed understanding of the catalytic mechanism.

  • Immunology and microbiology: Combined approaches could reveal how Lgt-processed lipoproteins interact with host immune receptors and contribute to pathogenesis.

  • Systems biology and molecular microbiology: Network-level analyses could place Lgt in the broader context of bacterial adaptation to host environments.

  • Drug delivery and medicinal chemistry: Collaboration between these fields could develop targeted delivery systems for Lgt inhibitors.

  • Synthetic biology and vaccine development: Engineering approaches could leverage Lgt function for the development of novel vaccine platforms with enhanced immunogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.