Recombinant Frankia alni ATP synthase subunit a (atpB)

Shipped with Ice Packs

In Stock

Cat. No.

BT2139623

Source

in vitro E.coli expression system

Synonyms

atpB; FRAAL5937; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6

Quick Inquiry

Description

Production and Purification

Expression system:

Parameter	Specification
Host	Escherichia coli
Tag	N-terminal His tag
Purity	>90% (SDS-PAGE)
Storage	Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
Reconstitution	0.1–1.0 mg/mL in sterile water + 50% glycerol

Stability:

Storage at -20°C/-80°C recommended; repeated freeze-thaw cycles degrade activity .

Functional Role in Symbiosis

Upregulation in nodules:

Fold change: ATP synthase genes (atpB, atpF, atpA) are upregulated 2–4× in Alnus glutinosa nodules compared to free-living cells .
Metabolic activity: Enhanced ATP synthase activity supports nitrogenase function (3% of total nodule proteome) .

Key symbiotic interactions:

Proton gradient maintenance: Essential for energizing nitrogenase-mediated N₂ fixation .
Coordination with nif and suf clusters: Facilitates Fe-S cluster assembly for nitrogenase maturation .

Comparative Genomic and Proteomic Data

Conservation across strains:

Strain	UniProt ID	Sequence Identity
F. alni ACN14a	Q0RDA8	100%
F. sp. EAN1pec	A8L3V9	94%

Transcriptomic analysis:

6/8 ATP synthase cluster genes (FRAAL5930–5937) upregulated in symbiosis .
Downregulation of ammonium assimilation genes (glnA, amtB) in nodules suggests metabolic prioritization of N₂ fixation .

Research Applications

Biochemical studies:

Used to characterize ATP synthase assembly and proton translocation mechanisms .
Proteogenomic tools: Enables tracking of F. alni metabolic shifts during symbiosis .

Genetic engineering:

Stable plasmid-based expression systems (e.g., pIGSAF) enable functional studies in F. alni .

Technical Limitations

Instability: Requires glycerol stabilization for long-term storage .
Low yield: Native membrane protein complexity limits high-throughput production .

Future Directions

Structural studies: Cryo-EM analysis to resolve proton channel architecture.
Metabolic modeling: Integrate ATP synthase activity with nitrogen fixation kinetics.

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will accommodate your needs.

Lead Time

Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.

Shelf Life

Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.

Synonyms

atpB; FRAAL5937; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-289

Protein Length

full length protein

Species

Frankia alni (strain ACN14a)

Target Names

atpB

Target Protein Sequence

MEVFVVPVLADEGFEGPTKEVFQTPHWFDVGIGSVNLYLNKATALTIFAALFVGVIFWLG FRRAKIIPRGIQNLCESAYDFVDLQIARGVIGEKGARYTPYLLVLFSFVLVSNVLAIIPA AQFPATSRIAVPMVLAVVTWVMFIYAGIKSNGAGAYFKEMIDPAPTAPLAIRLLLGPIEI LSTLIVRPFTLAIRLFANMFAGHLLLLVFSLGADYLLPKPPFVFGVASLLVAIVLTAFEL VIDALQAYIITILTAAYIGGAMAHGEHEVAPSEELAEHAPVGVPAAAHA

Uniprot No.

Q0RDA8

Target Background

Function

This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.

Database Links

KEGG: fal:FRAAL5937

STRING: 326424.FRAAL5937

Protein Families

ATPase A chain family

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Q&A

**# Recombinant Frankia alni ATP Synthase Subunit a (atpB): Frequently Asked Questions for Academic Researchers**

Advanced Research Questions

How does atpB contribute to Frankia alni’s nitrogen-fixing symbiosis with actinorhizal plants?

Methodological Answer:

Transcriptomics: Compare atpB expression in free-living vs. symbiotic Frankia using RNA-seq (source ).
- Key finding: atpB is upregulated 2.1-fold in nodules (p < 0.01) (source ).
Mutant studies: Use CRISPRi knockdown in Frankia to assess nodulation efficiency (source ).
Proteomics: Quantify ATP synthase subunits via SILAC or iTRAQ in symbiosis (source ).

Symbiotic Expression Data (Source ):

Condition	atpB Expression (FPKM)	Nitrogenase Activity (nmol C $_2$ H $_4$ /mg protein/hr)
Free-living (-N)	120 ± 15	0
Nodule (21 dpi)	250 ± 30	450 ± 50

How to resolve contradictions in atpB enzymatic kinetics across studies?

Methodological Answer:

Standardize assays: Use identical buffer systems (e.g., 50 mM Tris-HCl, pH 7.0, 5 mM MgCl $_2$ ) (source ).
Control for homologs: Screen for paralogs (e.g., atpB1 vs. atpB2) via BlastP (e-value <1e-10) (source ).
Data reconciliation: Apply meta-analysis tools like RevMan to compare V $_{max}$ and K $_m$ values (source ).

Reported Kinetic Discrepancies (Source ):

Study	V $_{max}$ (μmol/min/mg)	K $_m$ (mM ATP)	pH
Alloisio et al. 2010	8.2 ± 0.5	0.45 ± 0.05	7.0
Ni et al. 2019	12.1 ± 1.1	0.68 ± 0.08	7.5

What advanced techniques map atpB’s interactions with other respiratory chain components?

Methodological Answer:

Crosslinking-MS: Use DSSO or BS $^3$ crosslinkers to stabilize protein complexes, followed by Orbitrap Fusion Lumos analysis (source ).
Genetic interaction screens: Employ Tn-seq to identify co-essential genes with atpB (source ).
Molecular dynamics: Simulate atpB-subunit c interactions using GROMACS (source ).

Identified Interactors (Source ):

Protein	Function	Interaction Score (SAINT)
Subunit c (atpE)	F $_0$ rotor ring formation	0.98
Cytochrome bd oxidase	Oxidative phosphorylation	0.87

How does atpB deficiency affect Frankia alni’s stress response?

Methodological Answer:

Phenotypic microarrays: Use Biolog plates to assess metabolic shifts under osmotic stress (source ).
Proteomic profiling: Compare ΔatpB vs. wild-type via TMT labeling and LC-MS/MS (source ).
Fluorescence microscopy: Track cytoplasmic pH with BCECF-AM dye (source ).

Stress Response Data (Source ):

Stress Condition	Wild-Type Growth (OD $_{600}$ )	ΔatpB Growth (OD $_{600}$ )
Control	1.2 ± 0.1	1.1 ± 0.1
0.5 M NaCl	0.8 ± 0.05	0.3 ± 0.02*
20% PEG 8000	0.6 ± 0.04	0.1 ± 0.01*

Methodological Best Practices

Avoid freeze-thaw cycles: Aliquot recombinant atpB in 50% glycerol (source ).
Use non-denaturing detergents: 0.05% DDM for membrane protein solubilization (source ).
Validate antibodies: Test cross-reactivity against E. coli lysates (source ).

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Frankia alni ATP synthase subunit a (atpB)

Description

Production and Purification

Expression system:

Stability:

Functional Role in Symbiosis

Upregulation in nodules:

Key symbiotic interactions:

Comparative Genomic and Proteomic Data

Conservation across strains:

Transcriptomic analysis:

Research Applications

Biochemical studies:

Genetic engineering:

Technical Limitations

Future Directions

Product Specs

Target Background

Q&A

**# Recombinant Frankia alni ATP Synthase Subunit a (atpB): Frequently Asked Questions for Academic Researchers**

Advanced Research Questions

How does atpB contribute to Frankia alni’s nitrogen-fixing symbiosis with actinorhizal plants?

How to resolve contradictions in atpB enzymatic kinetics across studies?

What advanced techniques map atpB’s interactions with other respiratory chain components?

How does atpB deficiency affect Frankia alni’s stress response?

Methodological Best Practices

Quick Inquiry

Category

Service