Recombinant Frankia alni ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Frankia alni is a filamentous, nitrogen-fixing actinobacterium known for its symbiotic relationship with actinorhizal plants, such as Alnus species (alder trees) . This symbiosis enables these plants to thrive in nitrogen-poor soils by converting atmospheric dinitrogen to ammonia . ATP synthase, a crucial enzyme complex in cellular energy production, is vital for Frankia alni's metabolic processes within these symbiotic interactions . The ATP synthase subunit b (atpF) is a component of this enzyme complex. Recombinant forms of this subunit are produced for research purposes, allowing detailed studies of its structure, function, and interactions within the ATP synthase complex .

Genome and Genetic Context

The Frankia alni genome contains genes essential for symbiotic functions, including nitrogen fixation (nif), rhizobactin-related metabolite production (rhbBCEF), and carbon metabolism . Genes related to ATP synthase, including atpF, are crucial for energy generation to support these processes .

2.1. Genomic Mining

Comparative genomic analyses have identified genes conserved among different Frankia strains, distinguishing symbiotic and non-symbiotic types . These analyses often reveal genes like nif, rhbBCEF, sodF, accA, argF, and carbonic anhydrase (can) that play critical roles in the symbiotic lifestyle .

2.2. Gene Expression

Expression studies reveal that genes like can1 and ctp are upregulated under nitrogen starvation and symbiotic conditions, highlighting their importance in adapting to different environmental states .

Protein Structure and Function

ATP synthase, also known as F-ATPase, is a multi-subunit enzyme complex that synthesizes ATP using a proton gradient across the cell membrane. Subunit b (atpF) is a key component of the F0 sector, which is embedded in the membrane and responsible for proton translocation.

3.1. General Characteristics

CharacteristicDescription
Recommended NameATP synthase subunit a
Alternative NamesATP synthase F0 sector subunit a, F-ATPase subunit 6
Uniprot No.Q0RDA8
OrganismFrankia alni (strain ACN14a)
Purity>85% (SDS-PAGE)
SourceBaculovirus
Tag InfoDetermined during manufacturing
Protein LengthPartial

3.2. Role in ATP Synthase

Subunit b (atpF) is essential for connecting the F1 sector (the catalytic core) to the F0 sector, stabilizing the entire complex . It participates in the enzyme's rotary mechanism, facilitating proton flow and ATP synthesis .

4.1. Recombinant Production

Recombinant atpF is typically produced using expression systems like E. coli or baculovirus-infected insect cells . The choice of expression system depends on factors such as protein size, complexity, and post-translational modification requirements .

4.2. Purification

Affinity chromatography, using tags like His-tag or GST-tag fused to the recombinant protein, is commonly employed for purification . This method allows for high-specificity isolation of the protein from cell lysates .

4.3. Characterization

  • Purity Assessment: SDS-PAGE and Western blotting are used to verify the purity and identity of the recombinant protein .

  • Functional Assays: In vitro ATP hydrolysis or synthesis assays can assess the activity of the recombinant atpF when incorporated into the ATP synthase complex.

Research Findings and Significance

Studies involving recombinant Frankia alni atpF have provided insights into the symbiotic relationship and the bacterium's adaptation to different environmental conditions.

5.1. Symbiotic Transcriptome Analysis

Transcriptional analyses of Frankia alni cells in symbiosis with Alnus glutinosa have shown differential expression of ATP synthase genes . For example, six out of eight genes belonging to the ATP synthase cluster (FRAAL5930 to 5937) were upregulated in symbiotic conditions .

5.2. Metabolic Adaptations

Frankia alni exhibits metabolic flexibility, adjusting its carbon and nitrogen assimilation strategies based on environmental cues . Proteomic analyses have shown that under osmotic stress, Frankia alni increases the abundance of envelope-associated proteins while down-regulating pathways like nitrogen fixation and aerobic respiration .

5.3. Mutant Studies

Mutant studies involving ATP synthase subunits can reveal their roles in enzyme assembly and function. For example, disruption of genes involved in iron-sulfur cluster formation (sufBCDESU) affects nitrogen fixation ability, highlighting the interconnectedness of metabolic pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
atpF; FRAAL5935; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Frankia alni (strain ACN14a)
Target Names
atpF
Target Protein Sequence
MSASAAILLAASESGHSDENVLIPPLSELLIGTLAFGLLVAFFFWKIRPQIARTYAQRTE RIEGGIARAEAAQREAQALLEQYRAQLTEARAEAARIRDDAHTEGRQIVEELRASAQREI AEIKERADAQLAADRAQIVAQVRREVGVIAIDLASKIVGYQVESTATQARLVDDFIAALD NSAEGAGSSTPAPVGSGG
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of Frankia alni ATP synthase?

ATP synthase in Frankia alni consists of multiple subunits including the ATP synthase subunit a (atpB), which forms part of the F0 sector. This membrane-embedded protein complex plays a crucial role in energy metabolism by facilitating ATP synthesis through proton transport across membranes. The atpB gene encodes a 289-amino acid protein that contributes to the proton channel of the complex .

ATP synthase is essential for energy production in Frankia alni, particularly during its symbiotic nitrogen fixation with host plants like Alnus glutinosa. The protein's structure includes transmembrane domains that anchor it within the bacterial membrane, facilitating its role in the chemiosmotic coupling process.

How is recombinant Frankia alni ATP synthase typically expressed and purified?

Recombinant Frankia alni ATP synthase subunit a (atpB) is commonly expressed in E. coli expression systems using a His-tag fusion strategy for simplified purification. The typical workflow includes:

  • Cloning the atpB gene (1-289 aa) into an expression vector with an N-terminal His-tag

  • Transformation into an E. coli expression strain

  • Induction of protein expression under optimized conditions

  • Cell lysis and initial clarification

  • Purification via metal affinity chromatography utilizing the His-tag

  • Further purification steps if necessary (ion exchange, size exclusion chromatography)

  • Quality assessment by SDS-PAGE to ensure >90% purity

  • Lyophilization for long-term storage

The resulting protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C to prevent degradation from freeze-thaw cycles .

What expression systems are most effective for Frankia alni ATP synthase components?

E. coli expression systems have demonstrated high efficiency for recombinant production of Frankia alni ATP synthase subunits like atpB . When selecting an expression system, researchers should consider:

  • Codon optimization: Adapting codons to match E. coli preferences can significantly improve expression yields

  • Expression vectors: Those containing strong, inducible promoters like T7 are typically preferred

  • Host strains: BL21(DE3) and derivatives are commonly used for membrane protein expression

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the folding of membrane proteins

  • Detergents: Inclusion of appropriate detergents during purification is essential for maintaining protein stability and function

For particularly challenging ATP synthase components, alternative expression systems such as cell-free protein synthesis or specialized E. coli strains engineered for membrane protein expression might be considered when conventional approaches yield insufficient protein.

How does the expression of ATP synthase in Frankia alni change during symbiotic nitrogen fixation?

During symbiosis with Alnus glutinosa, Frankia alni shows significant overabundance of 250 proteins compared to nitrogen-replete pure cultures, with nitrogenase, SuF (Fe-Su biogenesis) and hopanoid lipid synthesis proteins being the most dramatically upregulated . This suggests a metabolic shift toward supporting the energy-intensive process of nitrogen fixation.

ATP production is critical during symbiosis, as nitrogenase activity requires substantial ATP input. The integration of ATP synthase function with carbon metabolism in symbiotic Frankia appears to be fine-tuned to support this energy demand while operating under the microaerobic conditions present in root nodules.

What methodological approaches best resolve the structure-function relationship of ATP synthase in Frankia species?

To properly investigate structure-function relationships of ATP synthase in Frankia species, a multi-technique approach is recommended:

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural insights into the intact ATP synthase complex

  • Site-directed mutagenesis: Systematically modifying key residues in the atpB sequence to identify functional domains

  • Enzyme kinetics assays: Measuring ATP synthesis/hydrolysis rates under various conditions

  • Reconstitution studies: Incorporating purified ATP synthase into liposomes to assess proton translocation

  • Biophysical techniques: Including circular dichroism, thermal shift assays, and hydrogen-deuterium exchange mass spectrometry

When examining membrane proteins like ATP synthase subunit a, it's critical to maintain the native-like lipid environment or use appropriate detergents during purification and analysis. Frankia-specific lipid compositions may be particularly important when studying functional aspects of the protein in reconstituted systems.

How do mutations in the atpB gene affect nitrogen fixation capacity in Frankia-actinorhizal symbioses?

Mutations in the atpB gene likely impact nitrogen fixation capacity through disruption of energy generation pathways essential for the highly ATP-demanding nitrogenase enzyme complex. Research should examine:

  • ATP production efficiency: Quantifying ATP synthesis rates in wildtype versus mutant strains

  • Nodulation phenotypes: Assessing whether atpB mutations affect the formation and development of actinorhizal nodules

  • Nitrogenase activity: Measuring acetylene reduction as a proxy for nitrogen fixation efficiency

  • Transcriptomic profiles: Comparing gene expression patterns between wildtype and atpB mutants under symbiotic conditions

  • Metabolic flux analysis: Tracking carbon and nitrogen flow through central metabolic pathways

Since nitrogenase constitutes approximately 3% of all Frankia proteins in nodules , any compromise in ATP production capability would likely have substantial downstream effects on nitrogen fixation efficiency. Experimental approaches should include both in vitro biochemical assays and in planta symbiosis studies to comprehensively assess the impact of atpB mutations.

How do alterations in the TCA cycle of Frankia strains impact ATP synthase function?

Frankia strains exhibit significant modifications to their TCA cycle, which directly influences energy metabolism and ATP synthase function. All examined Frankia genomes contain 2-oxoglutarate (2-OG) decarboxylase instead of 2-OG dehydrogenase, indicating they utilize a variant TCA cycle . Additionally, Frankia cluster-2 strains have lost genes encoding glyoxylate shunt enzymes and succinate semialdehyde dehydrogenase (SSA-DH), leading to TCA cycle linearization .

These modifications impact ATP synthase function through:

  • Altered electron transport chain input: The variant TCA cycle likely produces different ratios of reduced electron carriers

  • Metabolic adaptation to microaerobic conditions: Similar adaptations have been observed in rhizobia for catabolizing dicarboxylic acids under low oxygen conditions

  • Carbon flux redistribution: The linearized TCA cycle in cluster-2 strains changes how carbon skeletons are allocated

These metabolic adaptations appear to be evolutionary specializations that support symbiotic lifestyle, but they necessarily alter the energetic landscape in which ATP synthase operates. The lack of SSA-DH activity experimentally confirmed in Frankia coriariae BMG5.1 (cluster-2) compared to F. alni ACN14a demonstrates these metabolic differences are functionally significant .

What experimental approaches can accurately measure ATP synthase activity in different Frankia physiological states?

Accurately measuring ATP synthase activity across different Frankia physiological states requires specialized approaches addressing the unique characteristics of this actinobacterium:

  • Membrane vesicle preparations: Isolating inverted membrane vesicles to directly measure ATP synthesis driven by artificially imposed proton gradients

  • Oxygen consumption assays: Using oxygen electrodes to monitor respiratory activity coupled to ATP synthesis

  • Luciferase-based ATP quantification: Real-time measurement of ATP production under varying conditions

  • Isotope labeling studies: Tracking phosphate incorporation into ATP using 32P or 33P

  • Comparative expression analysis: Quantifying ATP synthase subunit expression across growth conditions using proteomics

Experimental considerations should include:

  • Growth conditions: Compare free-living versus symbiotic states, as well as varying nitrogen and carbon sources

  • Microaerobic adaptation: Account for Frankia's adaptation to low oxygen environments

  • Vesicle formation: Consider the impact of specialized nitrogen-fixing vesicles on energy metabolism

  • Host plant influence: In symbiotic studies, control for different host plant effects on Frankia metabolism

An integrated approach combining these methods provides the most complete assessment of ATP synthase function across Frankia physiological states.

What techniques best elucidate the assembly process of Frankia ATP synthase complexes?

The assembly of ATP synthase in Frankia represents a complex, multi-step process that can be investigated using several complementary approaches:

  • Blue native PAGE: Isolating intact complexes and subcomplexes to visualize assembly intermediates

  • Pulse-chase experiments: Tracking the incorporation of newly synthesized subunits into the mature complex

  • Co-immunoprecipitation: Identifying interaction partners during various assembly stages

  • Cross-linking mass spectrometry: Capturing transient interactions during the assembly process

  • Fluorescence microscopy with tagged subunits: Monitoring the spatiotemporal dynamics of assembly in living cells

When studying Frankia specifically, researchers should consider:

  • The potential role of specialized chaperones in ATP synthase assembly

  • The impact of membrane composition on complex formation

  • The influence of symbiotic versus free-living states on assembly kinetics

  • The possibility of assembly differences between vesicle membranes and cell membrane

A systematic approach combining these methods would provide insights into both the assembly pathway and potential regulatory mechanisms controlling ATP synthase biogenesis in Frankia.

How do post-translational modifications affect ATP synthase function in Frankia alni?

Post-translational modifications (PTMs) likely play significant roles in regulating ATP synthase function in Frankia alni, particularly during transitions between free-living and symbiotic states. Investigation should focus on:

  • Phosphorylation: Often regulates enzyme activity and is particularly relevant during rapid metabolic changes

  • Acetylation: May influence protein-protein interactions within the complex

  • S-nitrosylation: Potentially important given the microaerobic conditions during symbiosis

  • Lipid modifications: Could affect membrane integration and complex stability

Methodological approaches should include:

  • Phosphoproteomics: Identifying differentially phosphorylated sites across growth conditions

  • Mass spectrometry-based PTM mapping: Comprehensive identification of modification patterns

  • Site-directed mutagenesis: Creating non-modifiable variants to assess functional impact

  • In vitro enzymatic assays: Comparing the activity of modified versus unmodified proteins

The comparison between symbiotic and free-living states is particularly important, as differences in PTM patterns may reflect adaptation to the different energetic demands of nitrogen fixation versus saprophytic growth.

How has ATP synthase evolved across different Frankia clusters and what functional implications does this have?

Evolutionary analysis of ATP synthase across Frankia clusters reveals adaptations that likely reflect their diverse symbiotic relationships and metabolic capabilities. Key considerations include:

  • Sequence conservation: The ATP synthase core components show high conservation across Frankia strains, reflecting their essential function

  • Cluster-specific variations: Subtle amino acid changes may influence efficiency or regulatory properties

  • Co-evolution with metabolic pathways: The evolution of variant TCA cycles in Frankia necessarily impacts ATP synthase function

Functional implications include:

  • Energetic efficiency differences: Cluster-specific ATP synthase variants may exhibit different P/O ratios (ATP produced per oxygen consumed)

  • Regulatory sensitivity: Variations in regulatory domains could allow different response patterns to environmental signals

  • Adaptation to host plants: ATP synthase evolution may reflect adaptation to different carbon sources provided by diverse host plants

Research approaches should combine phylogenetic analysis with biochemical characterization of ATP synthase from representatives of different Frankia clusters, particularly comparing nitrogen-exporting versus nitrogen-assimilating strains.

What insights can comparative proteomics provide about ATP synthase expression in symbiotic versus free-living Frankia?

Comparative proteomics offers valuable insights into ATP synthase expression patterns between symbiotic and free-living Frankia states:

  • Quantitative differences: While major shifts occur in numerous proteins during symbiosis (250 proteins overabundant in nodules compared to free-living conditions) , the specific regulation pattern of ATP synthase subunits would provide insight into energy metabolism adaptations

  • Isoform switching: Potential expression of different ATP synthase subunit isoforms optimized for symbiotic conditions

  • Complex stoichiometry: Changes in the ratio of F1 versus F0 components could affect coupling efficiency

  • Co-regulated proteins: Identification of proteins whose expression patterns correlate with ATP synthase could reveal functional networks

Methodological considerations should include:

  • Sample preparation: Careful isolation of Frankia from nodules to minimize host contamination

  • Quantification approaches: Label-free versus isotope labeling methods

  • Data analysis: Pathway enrichment to place ATP synthase regulation in broader metabolic context

  • Validation: Targeted proteomics to confirm expression patterns of specific subunits

Integration with transcriptomic data would provide additional insight into regulatory mechanisms controlling ATP synthase expression during symbiotic transitions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.