Recombinant Frankia alni NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Protein Composition

The recombinant nuoK protein (UniProt ID: Q0RRV8) is a full-length polypeptide spanning amino acids 1–99. Key features include:

  • Gene Name: nuoK (synonyms: NADH dehydrogenase I subunit K, NDH-1 subunit K) .

  • Tag: N-terminal His-tag for affinity purification .

Production and Purity

ParameterDetailsSource
Expression HostE. coli
Purity>90% (SDS-PAGE analysis)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL), with 5–50% glycerol for stability

Biochemical Activity

NuoK is a subunit of the NADH-quinone oxidoreductase complex, which catalyzes the transfer of electrons from NADH to quinone. This reaction is coupled to proton translocation across the membrane, contributing to the proton motive force (PMF) essential for ATP synthesis . In Frankia alni, this enzyme is critical for maintaining energy metabolism during symbiosis with actinorhizal plants like Alnus glutinosa .

Mechanistic Insights from Analogous Systems

Studies on Na⁺-NQR (NADH-quinone oxidoreductase) from Vibrio cholerae provide mechanistic parallels:

  • Subunit Interactions: NADH dehydrogenase complexes require coordinated subunits for electron transfer and proton pumping. In Vibrio, the NqrF subunit (analogous to nuoK) facilitates quinone binding and stabilization .

  • Flavin and Iron-Sulfur Centers: Redox titrations in Vibrio reveal three n = 2 and one n = 1 redox centers, likely conserved in Frankia’s nuoK-containing complex .

Experimental Applications

The recombinant nuoK protein is primarily used in:

  • Structural Studies: His-tagged purification enables crystallization or cryo-EM analysis .

  • Enzyme Kinetics: Assessing NADH oxidation rates and quinone binding affinity in vitro .

Challenges and Future Directions

  • Symbiotic Context: Further studies are needed to link nuoK expression with Frankia’s metabolic adaptations in nodules.

  • Functional Redundancy: Frankia genomes may encode multiple NADH dehydrogenase isoforms, complicating subunit-specific analyses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; FRAAL1042; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Frankia alni (strain ACN14a)
Target Names
nuoK
Target Protein Sequence
MNPANYLILSALLFTIGTVGVLVRRNAIVVFMSIELMLNAVNLTLVTFSRINGTLDGQVM AFFVMVVAAAEVVIGLAIILSIFRTRRSASVDDVNLLKY
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Frankia alni NADH-quinone oxidoreductase subunit K (nuoK) and what is its biological significance?

Frankia alni NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the respiratory chain Complex I (NADH dehydrogenase) in the actinobacterium Frankia alni. This protein plays a crucial role in electron transport and energy metabolism. Frankia alni is a Gram-positive filamentous bacterium that establishes nitrogen-fixing symbiotic relationships with actinorhizal plants, particularly trees in the genus Alnus (alders). As part of the respiratory chain, nuoK contributes to the energy generation necessary for nitrogen fixation, where the bacterium converts atmospheric dinitrogen to ammonia, which is then provided to the host plant in exchange for photosynthates .

The nuoK protein is encoded by the nuoK gene (locus name FRAAL1042) in the Frankia alni genome . The protein's significance extends beyond basic metabolism, as energy generation is particularly important during symbiotic states when the bacterium needs to support the energetically demanding process of nitrogen fixation.

What is the molecular structure and characteristics of the Frankia alni nuoK protein?

The Frankia alni nuoK protein is a small hydrophobic membrane protein with the following characteristics:

PropertyDescription
Amino acid sequenceMNPANYLILSALLFTIGT VGVLVRRNAIVVFMSIELMLN AVNLTLVTFSRINGTLDGQVMA FFVMVVAAAEVVIGLAIILSIFRTRRSASVDDVNLLKY
Length99 amino acids
Molecular functionNADH-quinone oxidoreductase (EC 1.6.99.5)
Alternative namesNADH dehydrogenase I subunit K, NDH-1 subunit K
Gene locusFRAAL1042 in Frankia alni strain ACN14a
UniProt accessionQ0RRV8
Cellular locationIntegral membrane protein in the bacterial cytoplasmic membrane

The amino acid sequence reveals a highly hydrophobic protein with multiple transmembrane regions, consistent with its role as a membrane-spanning component of the respiratory complex . Structural predictions suggest that nuoK contains three transmembrane helices that anchor it within the cytoplasmic membrane, where it participates in electron transfer processes essential for energy generation.

What are the optimal conditions for expressing recombinant Frankia alni nuoK protein?

Expression of recombinant Frankia alni nuoK presents several challenges due to its hydrophobic nature and membrane localization. Based on research protocols for similar membrane proteins, the following methodology is recommended:

  • Expression system selection: Use of E. coli C41(DE3) or C43(DE3) strains, which are specifically designed for membrane protein expression, is recommended over standard BL21(DE3) strains.

  • Vector design:

    • Include a cleavable tag (His6, Strep-tag II, or MBP) to facilitate purification

    • Consider fusion with GFP at the C-terminus to monitor expression and folding

    • Ensure codon optimization for the expression host

  • Expression conditions:

    • Induction at lower temperatures (16-20°C) rather than 37°C

    • Lower IPTG concentrations (0.1-0.5 mM) for induction

    • Extended expression time (16-24 hours)

    • Addition of membrane-stabilizing agents (glycerol 5-10%)

  • Membrane fraction preparation:

    • Cell lysis via gentle methods (e.g., enzymatic lysis with lysozyme followed by sonication)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using mild detergents such as DDM, LMNG, or C12E8

Success of expression can be monitored via Western blotting and functional activity assays to ensure that the recombinant protein maintains its native conformation and activity .

What purification strategies are most effective for recombinant Frankia alni nuoK?

Purification of recombinant nuoK protein requires specialized approaches due to its hydrophobic nature. A multi-step purification strategy is recommended:

  • Membrane preparation and solubilization:

    • Isolate membrane fractions by ultracentrifugation

    • Solubilize using appropriate detergents (DDM at 1-2% w/v is common for initial solubilization)

    • Maintain detergent above critical micelle concentration (CMC) throughout purification

  • Affinity chromatography:

    • For His-tagged nuoK: immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer composition: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, detergent at 2-3× CMC

    • Gradient elution with imidazole (20-500 mM)

  • Size exclusion chromatography:

    • Further purification using Superdex 200 or similar matrix

    • Assessment of protein oligomeric state and homogeneity

  • Quality control assessment:

    • SDS-PAGE analysis for purity

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure evaluation

    • Thermal stability assays

Storage of purified nuoK should be in buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent at 2-3× CMC, and 50% glycerol at -20°C or -80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can the NADH-quinone oxidoreductase activity of Frankia alni nuoK be measured in vitro?

The enzymatic activity of nuoK as part of the NADH-quinone oxidoreductase complex can be assessed using several complementary approaches:

  • NADH oxidation assay:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Reaction mixture: 50 mM potassium phosphate buffer (pH 7.5), 100 μM NADH, 100 μM ubiquinone-1 (Q1) or decylubiquinone, and purified protein

    • Activity is calculated as μmol NADH oxidized/min/mg protein

  • Electron transfer to artificial acceptors:

    • Using ferricyanide or 2,6-dichlorophenolindophenol (DCPIP) as electron acceptors

    • Monitoring reduction at respective wavelengths (420 nm for ferricyanide, 600 nm for DCPIP)

  • Oxygen consumption measurements:

    • Using Clark-type oxygen electrode

    • Reaction mixture similar to NADH oxidation assay

    • Measuring oxygen consumption rate in the presence of substrate

  • Inhibitor sensitivity profiling:

    • Testing sensitivity to known Complex I inhibitors (rotenone, piericidin A)

    • IC50 determination for comparative analysis

    • Inhibitor resistance pattern characterization

When assessing activity, it's important to establish whether isolated nuoK maintains activity or whether it needs to be reconstituted with other subunits of the NADH-quinone oxidoreductase complex to function properly .

What is the role of Frankia alni nuoK in symbiotic nitrogen fixation?

The nuoK protein, as part of Complex I in the respiratory chain, plays several critical roles in supporting symbiotic nitrogen fixation:

  • Energy generation for nitrogenase activity:

    • Nitrogen fixation is highly energy-intensive, requiring approximately 16 ATP molecules per N₂ molecule reduced

    • nuoK contributes to ATP generation through the respiratory chain and oxidative phosphorylation

  • Regulation of oxygen tension:

    • Nitrogenase is extremely oxygen-sensitive

    • Respiratory activity helps maintain low oxygen conditions in nitrogen-fixing vesicles

  • Redox balance maintenance:

    • Provides recycling of reduced cofactors generated during metabolism

    • Helps maintain optimal intracellular redox potential

Transcriptomic and proteogenomic studies have shown significant changes in the expression of respiratory chain components, including nuoK, during symbiotic conditions compared to free-living states. In symbiotic Frankia alni within Alnus glutinosa nodules, proteomic analysis has identified differential expression of various proteins including those involved in energy metabolism .

The importance of respiratory function is highlighted by observations that Frankia alni is metabolically more active in symbiosis than comparable rhizobia in their symbiotic states, suggesting a higher energy demand that would necessitate increased respiratory chain activity .

How does the structure and function of Frankia alni nuoK compare with homologous proteins in other nitrogen-fixing bacteria?

Comparative analysis of nuoK across nitrogen-fixing bacteria reveals insights into evolutionary adaptation and functional specialization:

OrganismnuoK homologSequence identity to F. alni nuoKStructural featuresFunctional adaptations
Frankia alninuoK100%3 transmembrane helicesAdapted for symbiotic lifestyle
Rhizobium leguminosarumnuoK~35-40%Similar membrane topologyAdapted for legume symbiosis
Azotobacter vinelandiinuoK~30-35%Conserved core structureAdapted for free-living diazotrophy
Klebsiella pneumoniaenuoK~25-30%Divergent regions in loopsFacultative nitrogen fixation
Anabaena sp.homolog present~20-25%Additional domainsAdapted for heterocyst formation

Key findings from comparative analyses indicate:

  • Conserved core structure across diverse nitrogen-fixing bacteria, reflecting essential function in electron transport

  • Variable regions particularly in loop domains, suggesting adaptation to different cellular environments and energy demands

  • Divergent expression patterns with Frankia alni showing higher upregulation during symbiosis compared to rhizobia, corresponding to its higher metabolic activity in symbiotic state

  • Different regulatory patterns with respect to oxygen and nitrogen availability, reflecting the various ecological niches occupied by different diazotrophs

These comparisons suggest that while the core function of nuoK in electron transport is conserved, specific adaptations have occurred to optimize energy generation in different nitrogen-fixing contexts .

What genetic approaches can be used to study the function of nuoK in Frankia alni?

  • Heterologous expression and complementation:

    • Expression of Frankia alni nuoK in model organisms like E. coli

    • Complementation studies in E. coli or yeast nuoK mutants

    • Analysis of whether F. alni nuoK can restore function in these systems

  • Site-directed mutagenesis and structure-function analysis:

    • Creation of point mutations in conserved residues

    • Expression of mutant proteins to identify essential amino acids

    • Correlation of mutations with changes in activity or stability

  • Antisense RNA and RNA interference approaches:

    • Design of antisense constructs targeting nuoK mRNA

    • Introduction into Frankia via electroporation

    • Analysis of phenotypic effects of reduced nuoK expression

  • Development of genetic transformation systems:

    • Recent progress in establishing stable genetic transformation for Frankia could enable direct genetic manipulation

    • CRISPR-Cas9 systems adapted for actinobacteria might be applicable

    • Transposon mutagenesis approaches to disrupt nuoK

  • Transcriptomic and proteomic analysis:

    • RNA-seq analysis under varying conditions to identify co-regulated genes

    • Proteomic analysis to identify interaction partners

    • Metabolomic profiling to correlate nuoK expression with metabolic states

How does the expression of Frankia alni nuoK change during different stages of symbiotic establishment with Alnus glutinosa?

The expression pattern of nuoK throughout the symbiotic process reveals important insights into its role during different stages of the Frankia-Alnus relationship:

  • Pre-infection stage:

    • Baseline expression levels similar to free-living state

    • Gradual increase in expression upon detection of plant signals

    • Correlation with preparation for metabolic changes

  • Early infection and nodule development:

    • Significant upregulation as energy demands increase

    • Coordinated expression with other respiratory chain components

    • Temporal alignment with initial penetration of root hairs

  • Mature symbiotic state:

    • High sustained expression levels

    • Integration with nitrogen fixation (nif) gene expression

    • Proteomic studies show substantial abundance in mature nodules

Transcriptomic analyses comparing nitrogen-replete free-living Frankia alni cells with bacteria in Alnus glutinosa nodules have demonstrated significant modulation of genes involved in energy metabolism . While specific data on nuoK is limited, proteogenomic studies of symbiotic Frankia alni have identified numerous overproduced proteins in the symbiotic state, with some respiratory chain components showing fold changes of 2 or greater .

The expression profile correlates with the increased energy demand during nitrogen fixation, where the bacterium must support the ATP-intensive nitrogenase reaction while maintaining appropriate redox balance and oxygen protection mechanisms.

What are the latest analytical techniques for studying membrane-bound proteins like Frankia alni nuoK?

Recent methodological advances have significantly improved our ability to study challenging membrane proteins like nuoK:

  • Cryo-electron microscopy (cryo-EM):

    • Near-atomic resolution structures without crystallization

    • Visualization of proteins in native-like lipid environments

    • Application to respiratory complexes including NADH-quinone oxidoreductase

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of subunit stoichiometry and interaction dynamics

    • Identification of associated lipids and small molecules

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probing protein dynamics and conformational changes

    • Mapping protein-protein interaction interfaces

    • Assessment of structural changes upon ligand binding

  • Single-particle tracking and super-resolution microscopy:

    • Visualization of membrane protein distribution and dynamics

    • Tracking of protein movement in bacterial membranes

    • Correlation with function and metabolic state

  • Nanodiscs and polymer-based membrane mimetics:

    • Stabilization of membrane proteins in native-like environments

    • Improved functional preservation during purification

    • Compatibility with structural and functional studies

  • Microfluidics and droplet-based assays:

    • High-throughput functional analysis

    • Miniaturized assay platforms for limited sample amounts

    • Integration with other analytical techniques

These techniques can be applied to nuoK to better understand its structure, interactions, and functional mechanisms in the context of Frankia alni's unique symbiotic lifestyle and nitrogen-fixing capabilities.

How can isotope labeling approaches be used to study the function of nuoK in nitrogen fixation?

Isotope labeling provides powerful tools for investigating nuoK function in the context of nitrogen fixation:

  • ¹⁵N labeling for nitrogen flux analysis:

    • Tracking the fate of fixed nitrogen through metabolic pathways

    • Correlation of nitrogen fixation rates with nuoK expression levels

    • Distinguishing bacterially-fixed nitrogen from other nitrogen sources

  • ¹³C labeling for metabolic flux analysis:

    • Tracing carbon flow through central metabolism

    • Quantifying energetic costs of nitrogen fixation

    • Assessing metabolic adjustments in response to nuoK modification

  • ²H (deuterium) labeling for protein dynamics:

    • Hydrogen-deuterium exchange to probe structural dynamics

    • Identifying conformational changes during electron transport

    • Mapping protein-protein interaction surfaces

  • Heavy isotope labeling for quantitative proteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • iTRAQ (Isobaric Tags for Relative and Absolute Quantitation)

    • Quantitative comparison of nuoK expression under different conditions

  • ¹⁸O labeling for oxygen consumption studies:

    • Tracking oxygen utilization during respiration

    • Correlating respiratory activity with nitrogen fixation

    • Assessing oxygen protection mechanisms

What are the potential applications of understanding Frankia alni nuoK for improving plant-microbe symbioses?

Understanding the role of nuoK in Frankia-Alnus symbiosis could have several applications for optimizing and extending plant-microbe interactions:

  • Engineering more efficient nitrogen fixation systems:

    • Modification of respiratory chain components to improve energy efficiency

    • Optimization of electron transport for enhanced nitrogenase activity

    • Development of symbiotic relationships with reduced oxygen sensitivity

  • Extending symbiotic range to non-host plants:

    • Identification of respiratory adaptations required for different plant partners

    • Engineering Frankia strains with modified respiratory capacity for new hosts

    • Creating synthetic symbioses with optimized energy metabolism

  • Improving plant growth under stress conditions:

    • Enhanced energy generation mechanisms for stress tolerance

    • Respiratory adaptations for symbiosis under suboptimal conditions

    • Drought and salinity tolerance through improved symbiotic efficiency

  • Developing biofertilization strategies:

    • Creation of optimized Frankia strains for specific agricultural applications

    • Reduced dependence on chemical nitrogen fertilizers

    • Integration of actinorhizal plants in sustainable agricultural systems

  • Ecological restoration applications:

    • Improved Frankia-Alnus symbioses for reforestation of degraded lands

    • Enhanced nitrogen contribution to forest ecosystems

    • Adaptation to changing climate conditions

The fundamental understanding of respiratory chain components like nuoK provides a foundation for these applications by elucidating how energy metabolism supports the energetically demanding process of biological nitrogen fixation .

What unresolved questions remain about the structure-function relationship of Frankia alni nuoK?

Despite progress in understanding Frankia alni nuoK, several critical questions remain unanswered:

  • High-resolution structural information:

    • What is the precise three-dimensional structure of nuoK?

    • How does it integrate within the larger Complex I structure?

    • What structural adaptations distinguish it from homologs in non-symbiotic bacteria?

  • Proton translocation mechanism:

    • How does nuoK contribute to the proton pumping function of Complex I?

    • Which amino acid residues are essential for this process?

    • How is proton translocation coupled to electron transfer?

  • Regulatory mechanisms:

    • How is nuoK expression regulated in response to symbiotic signals?

    • What post-translational modifications occur during symbiosis?

    • How does oxygen tension affect nuoK function and regulation?

  • Interaction with plant-derived factors:

    • Do plant metabolites directly interact with or regulate nuoK?

    • Is nuoK function modified by the plant microenvironment in nodules?

    • Are there plant-derived inhibitors or activators of nuoK?

  • Evolution and adaptation:

    • How has nuoK evolved in Frankia compared to non-symbiotic relatives?

    • What selective pressures have shaped its function in nitrogen-fixing symbionts?

    • Can phylogenetic analysis of nuoK inform host specificity?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The results could provide deeper insights into the fundamental mechanisms of respiratory electron transport in the context of symbiotic nitrogen fixation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.