The recombinant nuoK protein (UniProt ID: Q0RRV8) is a full-length polypeptide spanning amino acids 1–99. Key features include:
NuoK is a subunit of the NADH-quinone oxidoreductase complex, which catalyzes the transfer of electrons from NADH to quinone. This reaction is coupled to proton translocation across the membrane, contributing to the proton motive force (PMF) essential for ATP synthesis . In Frankia alni, this enzyme is critical for maintaining energy metabolism during symbiosis with actinorhizal plants like Alnus glutinosa .
Studies on Na⁺-NQR (NADH-quinone oxidoreductase) from Vibrio cholerae provide mechanistic parallels:
Subunit Interactions: NADH dehydrogenase complexes require coordinated subunits for electron transfer and proton pumping. In Vibrio, the NqrF subunit (analogous to nuoK) facilitates quinone binding and stabilization .
Flavin and Iron-Sulfur Centers: Redox titrations in Vibrio reveal three n = 2 and one n = 1 redox centers, likely conserved in Frankia’s nuoK-containing complex .
The recombinant nuoK protein is primarily used in:
Structural Studies: His-tagged purification enables crystallization or cryo-EM analysis .
Enzyme Kinetics: Assessing NADH oxidation rates and quinone binding affinity in vitro .
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
KEGG: fal:FRAAL1042
STRING: 326424.FRAAL1042
Frankia alni NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the respiratory chain Complex I (NADH dehydrogenase) in the actinobacterium Frankia alni. This protein plays a crucial role in electron transport and energy metabolism. Frankia alni is a Gram-positive filamentous bacterium that establishes nitrogen-fixing symbiotic relationships with actinorhizal plants, particularly trees in the genus Alnus (alders). As part of the respiratory chain, nuoK contributes to the energy generation necessary for nitrogen fixation, where the bacterium converts atmospheric dinitrogen to ammonia, which is then provided to the host plant in exchange for photosynthates .
The nuoK protein is encoded by the nuoK gene (locus name FRAAL1042) in the Frankia alni genome . The protein's significance extends beyond basic metabolism, as energy generation is particularly important during symbiotic states when the bacterium needs to support the energetically demanding process of nitrogen fixation.
The Frankia alni nuoK protein is a small hydrophobic membrane protein with the following characteristics:
| Property | Description |
|---|---|
| Amino acid sequence | MNPANYLILSALLFTIGT VGVLVRRNAIVVFMSIELMLN AVNLTLVTFSRINGTLDGQVMA FFVMVVAAAEVVIGLAIILSIFRTRRSASVDDVNLLKY |
| Length | 99 amino acids |
| Molecular function | NADH-quinone oxidoreductase (EC 1.6.99.5) |
| Alternative names | NADH dehydrogenase I subunit K, NDH-1 subunit K |
| Gene locus | FRAAL1042 in Frankia alni strain ACN14a |
| UniProt accession | Q0RRV8 |
| Cellular location | Integral membrane protein in the bacterial cytoplasmic membrane |
The amino acid sequence reveals a highly hydrophobic protein with multiple transmembrane regions, consistent with its role as a membrane-spanning component of the respiratory complex . Structural predictions suggest that nuoK contains three transmembrane helices that anchor it within the cytoplasmic membrane, where it participates in electron transfer processes essential for energy generation.
Expression of recombinant Frankia alni nuoK presents several challenges due to its hydrophobic nature and membrane localization. Based on research protocols for similar membrane proteins, the following methodology is recommended:
Expression system selection: Use of E. coli C41(DE3) or C43(DE3) strains, which are specifically designed for membrane protein expression, is recommended over standard BL21(DE3) strains.
Vector design:
Include a cleavable tag (His6, Strep-tag II, or MBP) to facilitate purification
Consider fusion with GFP at the C-terminus to monitor expression and folding
Ensure codon optimization for the expression host
Expression conditions:
Induction at lower temperatures (16-20°C) rather than 37°C
Lower IPTG concentrations (0.1-0.5 mM) for induction
Extended expression time (16-24 hours)
Addition of membrane-stabilizing agents (glycerol 5-10%)
Membrane fraction preparation:
Cell lysis via gentle methods (e.g., enzymatic lysis with lysozyme followed by sonication)
Differential centrifugation to isolate membrane fractions
Solubilization using mild detergents such as DDM, LMNG, or C12E8
Success of expression can be monitored via Western blotting and functional activity assays to ensure that the recombinant protein maintains its native conformation and activity .
Purification of recombinant nuoK protein requires specialized approaches due to its hydrophobic nature. A multi-step purification strategy is recommended:
Membrane preparation and solubilization:
Isolate membrane fractions by ultracentrifugation
Solubilize using appropriate detergents (DDM at 1-2% w/v is common for initial solubilization)
Maintain detergent above critical micelle concentration (CMC) throughout purification
Affinity chromatography:
For His-tagged nuoK: immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Buffer composition: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, detergent at 2-3× CMC
Gradient elution with imidazole (20-500 mM)
Size exclusion chromatography:
Further purification using Superdex 200 or similar matrix
Assessment of protein oligomeric state and homogeneity
Quality control assessment:
SDS-PAGE analysis for purity
Mass spectrometry for identity confirmation
Circular dichroism for secondary structure evaluation
Thermal stability assays
Storage of purified nuoK should be in buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent at 2-3× CMC, and 50% glycerol at -20°C or -80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .
The enzymatic activity of nuoK as part of the NADH-quinone oxidoreductase complex can be assessed using several complementary approaches:
NADH oxidation assay:
Spectrophotometric monitoring of NADH oxidation at 340 nm
Reaction mixture: 50 mM potassium phosphate buffer (pH 7.5), 100 μM NADH, 100 μM ubiquinone-1 (Q1) or decylubiquinone, and purified protein
Activity is calculated as μmol NADH oxidized/min/mg protein
Electron transfer to artificial acceptors:
Using ferricyanide or 2,6-dichlorophenolindophenol (DCPIP) as electron acceptors
Monitoring reduction at respective wavelengths (420 nm for ferricyanide, 600 nm for DCPIP)
Oxygen consumption measurements:
Using Clark-type oxygen electrode
Reaction mixture similar to NADH oxidation assay
Measuring oxygen consumption rate in the presence of substrate
Inhibitor sensitivity profiling:
Testing sensitivity to known Complex I inhibitors (rotenone, piericidin A)
IC50 determination for comparative analysis
Inhibitor resistance pattern characterization
When assessing activity, it's important to establish whether isolated nuoK maintains activity or whether it needs to be reconstituted with other subunits of the NADH-quinone oxidoreductase complex to function properly .
The nuoK protein, as part of Complex I in the respiratory chain, plays several critical roles in supporting symbiotic nitrogen fixation:
Energy generation for nitrogenase activity:
Nitrogen fixation is highly energy-intensive, requiring approximately 16 ATP molecules per N₂ molecule reduced
nuoK contributes to ATP generation through the respiratory chain and oxidative phosphorylation
Regulation of oxygen tension:
Nitrogenase is extremely oxygen-sensitive
Respiratory activity helps maintain low oxygen conditions in nitrogen-fixing vesicles
Redox balance maintenance:
Provides recycling of reduced cofactors generated during metabolism
Helps maintain optimal intracellular redox potential
Transcriptomic and proteogenomic studies have shown significant changes in the expression of respiratory chain components, including nuoK, during symbiotic conditions compared to free-living states. In symbiotic Frankia alni within Alnus glutinosa nodules, proteomic analysis has identified differential expression of various proteins including those involved in energy metabolism .
The importance of respiratory function is highlighted by observations that Frankia alni is metabolically more active in symbiosis than comparable rhizobia in their symbiotic states, suggesting a higher energy demand that would necessitate increased respiratory chain activity .
Comparative analysis of nuoK across nitrogen-fixing bacteria reveals insights into evolutionary adaptation and functional specialization:
| Organism | nuoK homolog | Sequence identity to F. alni nuoK | Structural features | Functional adaptations |
|---|---|---|---|---|
| Frankia alni | nuoK | 100% | 3 transmembrane helices | Adapted for symbiotic lifestyle |
| Rhizobium leguminosarum | nuoK | ~35-40% | Similar membrane topology | Adapted for legume symbiosis |
| Azotobacter vinelandii | nuoK | ~30-35% | Conserved core structure | Adapted for free-living diazotrophy |
| Klebsiella pneumoniae | nuoK | ~25-30% | Divergent regions in loops | Facultative nitrogen fixation |
| Anabaena sp. | homolog present | ~20-25% | Additional domains | Adapted for heterocyst formation |
Key findings from comparative analyses indicate:
Conserved core structure across diverse nitrogen-fixing bacteria, reflecting essential function in electron transport
Variable regions particularly in loop domains, suggesting adaptation to different cellular environments and energy demands
Divergent expression patterns with Frankia alni showing higher upregulation during symbiosis compared to rhizobia, corresponding to its higher metabolic activity in symbiotic state
Different regulatory patterns with respect to oxygen and nitrogen availability, reflecting the various ecological niches occupied by different diazotrophs
These comparisons suggest that while the core function of nuoK in electron transport is conserved, specific adaptations have occurred to optimize energy generation in different nitrogen-fixing contexts .
Heterologous expression and complementation:
Expression of Frankia alni nuoK in model organisms like E. coli
Complementation studies in E. coli or yeast nuoK mutants
Analysis of whether F. alni nuoK can restore function in these systems
Site-directed mutagenesis and structure-function analysis:
Creation of point mutations in conserved residues
Expression of mutant proteins to identify essential amino acids
Correlation of mutations with changes in activity or stability
Antisense RNA and RNA interference approaches:
Design of antisense constructs targeting nuoK mRNA
Introduction into Frankia via electroporation
Analysis of phenotypic effects of reduced nuoK expression
Development of genetic transformation systems:
Recent progress in establishing stable genetic transformation for Frankia could enable direct genetic manipulation
CRISPR-Cas9 systems adapted for actinobacteria might be applicable
Transposon mutagenesis approaches to disrupt nuoK
Transcriptomic and proteomic analysis:
RNA-seq analysis under varying conditions to identify co-regulated genes
Proteomic analysis to identify interaction partners
Metabolomic profiling to correlate nuoK expression with metabolic states
The expression pattern of nuoK throughout the symbiotic process reveals important insights into its role during different stages of the Frankia-Alnus relationship:
Pre-infection stage:
Baseline expression levels similar to free-living state
Gradual increase in expression upon detection of plant signals
Correlation with preparation for metabolic changes
Early infection and nodule development:
Significant upregulation as energy demands increase
Coordinated expression with other respiratory chain components
Temporal alignment with initial penetration of root hairs
Mature symbiotic state:
High sustained expression levels
Integration with nitrogen fixation (nif) gene expression
Proteomic studies show substantial abundance in mature nodules
Transcriptomic analyses comparing nitrogen-replete free-living Frankia alni cells with bacteria in Alnus glutinosa nodules have demonstrated significant modulation of genes involved in energy metabolism . While specific data on nuoK is limited, proteogenomic studies of symbiotic Frankia alni have identified numerous overproduced proteins in the symbiotic state, with some respiratory chain components showing fold changes of 2 or greater .
The expression profile correlates with the increased energy demand during nitrogen fixation, where the bacterium must support the ATP-intensive nitrogenase reaction while maintaining appropriate redox balance and oxygen protection mechanisms.
Recent methodological advances have significantly improved our ability to study challenging membrane proteins like nuoK:
Cryo-electron microscopy (cryo-EM):
Near-atomic resolution structures without crystallization
Visualization of proteins in native-like lipid environments
Application to respiratory complexes including NADH-quinone oxidoreductase
Native mass spectrometry:
Analysis of intact membrane protein complexes
Determination of subunit stoichiometry and interaction dynamics
Identification of associated lipids and small molecules
Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
Probing protein dynamics and conformational changes
Mapping protein-protein interaction interfaces
Assessment of structural changes upon ligand binding
Single-particle tracking and super-resolution microscopy:
Visualization of membrane protein distribution and dynamics
Tracking of protein movement in bacterial membranes
Correlation with function and metabolic state
Nanodiscs and polymer-based membrane mimetics:
Stabilization of membrane proteins in native-like environments
Improved functional preservation during purification
Compatibility with structural and functional studies
Microfluidics and droplet-based assays:
High-throughput functional analysis
Miniaturized assay platforms for limited sample amounts
Integration with other analytical techniques
These techniques can be applied to nuoK to better understand its structure, interactions, and functional mechanisms in the context of Frankia alni's unique symbiotic lifestyle and nitrogen-fixing capabilities.
Isotope labeling provides powerful tools for investigating nuoK function in the context of nitrogen fixation:
¹⁵N labeling for nitrogen flux analysis:
Tracking the fate of fixed nitrogen through metabolic pathways
Correlation of nitrogen fixation rates with nuoK expression levels
Distinguishing bacterially-fixed nitrogen from other nitrogen sources
¹³C labeling for metabolic flux analysis:
Tracing carbon flow through central metabolism
Quantifying energetic costs of nitrogen fixation
Assessing metabolic adjustments in response to nuoK modification
²H (deuterium) labeling for protein dynamics:
Hydrogen-deuterium exchange to probe structural dynamics
Identifying conformational changes during electron transport
Mapping protein-protein interaction surfaces
Heavy isotope labeling for quantitative proteomics:
SILAC (Stable Isotope Labeling with Amino acids in Cell culture)
iTRAQ (Isobaric Tags for Relative and Absolute Quantitation)
Quantitative comparison of nuoK expression under different conditions
¹⁸O labeling for oxygen consumption studies:
Tracking oxygen utilization during respiration
Correlating respiratory activity with nitrogen fixation
Assessing oxygen protection mechanisms
Understanding the role of nuoK in Frankia-Alnus symbiosis could have several applications for optimizing and extending plant-microbe interactions:
Engineering more efficient nitrogen fixation systems:
Modification of respiratory chain components to improve energy efficiency
Optimization of electron transport for enhanced nitrogenase activity
Development of symbiotic relationships with reduced oxygen sensitivity
Extending symbiotic range to non-host plants:
Identification of respiratory adaptations required for different plant partners
Engineering Frankia strains with modified respiratory capacity for new hosts
Creating synthetic symbioses with optimized energy metabolism
Improving plant growth under stress conditions:
Enhanced energy generation mechanisms for stress tolerance
Respiratory adaptations for symbiosis under suboptimal conditions
Drought and salinity tolerance through improved symbiotic efficiency
Developing biofertilization strategies:
Creation of optimized Frankia strains for specific agricultural applications
Reduced dependence on chemical nitrogen fertilizers
Integration of actinorhizal plants in sustainable agricultural systems
Ecological restoration applications:
Improved Frankia-Alnus symbioses for reforestation of degraded lands
Enhanced nitrogen contribution to forest ecosystems
Adaptation to changing climate conditions
The fundamental understanding of respiratory chain components like nuoK provides a foundation for these applications by elucidating how energy metabolism supports the energetically demanding process of biological nitrogen fixation .
Despite progress in understanding Frankia alni nuoK, several critical questions remain unanswered:
High-resolution structural information:
What is the precise three-dimensional structure of nuoK?
How does it integrate within the larger Complex I structure?
What structural adaptations distinguish it from homologs in non-symbiotic bacteria?
Proton translocation mechanism:
How does nuoK contribute to the proton pumping function of Complex I?
Which amino acid residues are essential for this process?
How is proton translocation coupled to electron transfer?
Regulatory mechanisms:
How is nuoK expression regulated in response to symbiotic signals?
What post-translational modifications occur during symbiosis?
How does oxygen tension affect nuoK function and regulation?
Interaction with plant-derived factors:
Do plant metabolites directly interact with or regulate nuoK?
Is nuoK function modified by the plant microenvironment in nodules?
Are there plant-derived inhibitors or activators of nuoK?
Evolution and adaptation:
How has nuoK evolved in Frankia compared to non-symbiotic relatives?
What selective pressures have shaped its function in nitrogen-fixing symbionts?
Can phylogenetic analysis of nuoK inform host specificity?
Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The results could provide deeper insights into the fundamental mechanisms of respiratory electron transport in the context of symbiotic nitrogen fixation .