Recombinant Frankia sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane component of the NADH dehydrogenase complex (Complex I) in Frankia species. The recombinant variant is expressed in E. coli with an N-terminal His tag for purification . Key properties include:

ParameterDetails
UniProt IDQ2JFL0 (Frankia casuarinae)
Amino Acid Sequence1-99aa: MNPANYLILSALLFTIGTVGVLVRRNAIVVFMSVELMLNAVNLTLVTFSRIHGTLDGQIM...
Molecular Weight~11 kDa (calculated)
Purity>90% (SDS-PAGE verified)
Storage ConditionsLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

This enzyme is part of the NADH dehydrogenase I (NDH-1) complex, which shuttles electrons from NADH to ubiquinone while translocating protons, contributing to the proton motive force .

Recombinant Production and Quality Control

The protein is synthesized in E. coli systems, with protocols optimized for solubility and yield:

  • Expression System: E. coli (BL21 or similar strains) .

  • Tag: N-terminal His tag for affinity chromatography .

  • Reconstitution: Requires solubilization in deionized water (0.1–1.0 mg/mL) with glycerol (5–50%) for stability .

  • Stability: Degrades upon repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

Comparative Analysis of Bacterial NADH:Quinone Oxidoreductases

The table below contextualizes nuoK within bacterial respiratory enzymes :

OrganismNDH-1NDH-2NQR
Frankia casuarinaeYesNoNo
Vibrio choleraeNoNoYes
Bacillus subtilisNoYesYes
Escherichia coliYesYesNo

NDH-1 (nuoK-containing) systems are prevalent in bacteria requiring proton-pumping efficiency, whereas NQR or NDH-2 dominates in organisms utilizing sodium gradients or simpler electron transport .

Applications and Future Directions

Recombinant nuoK serves as a tool for:

  • Respiratory Chain Studies: Probing electron transfer mechanisms and ion translocation .

  • Biotechnological Engineering: Optimizing microbial fuel cells or synthetic pathways requiring efficient NADH oxidation .

  • Drug Target Exploration: Homologous enzymes in pathogens (e.g., V. cholerae) are validated targets for antimicrobials .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to suit your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; Franean1_6084; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Frankia sp. (strain EAN1pec)
Target Names
nuoK
Target Protein Sequence
MNPANYLILSGLLFTIGATGVLVRRNAIVVFMSIELMLNAVNLTLVTFSRIHGTLEGQIM AFFVMVVAAAEVVVGLAIILAIFRTRRSASVDDVNLLKY
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediate carriers. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, generating a proton gradient that stores the redox energy.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Frankia sp. and what role does it play in nitrogen fixation?

Frankia species are nitrogen-fixing actinobacteria that form symbiotic relationships with actinorhizal plants. Strains such as AgB32 and AgKG'84/4 are typically isolated from root nodules of plants like Alnus glutinosa . These bacteria play a crucial ecological role through their ability to convert atmospheric nitrogen into bioavailable forms through the process of nitrogen fixation. The genomes of Frankia strains typically range from 6.3 to 6.7 Mb, containing specialized gene clusters essential for symbiotic relationships and nitrogen fixation capabilities .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of Complex I (NADH dehydrogenase I) in the respiratory electron transport chain. This protein functions as a membrane-embedded subunit that participates in proton translocation across bacterial membranes . The nuoK protein in Frankia sp. consists of 99 amino acids and is characterized by highly hydrophobic regions forming transmembrane segments . As part of the larger NADH dehydrogenase complex, nuoK contributes to energy conservation during respiration, which indirectly supports nitrogen fixation by providing the substantial energy requirements needed for this metabolically demanding process.

How is the nuoK gene organized in the Frankia genome?

The nuoK gene is typically found within the nuo operon that encodes the subunits of the NADH dehydrogenase I complex. Genomic analyses of Frankia strains like AgB32 and AgKG'84/4 reveal that the nuoK gene is preserved even in strains undergoing genome erosion, highlighting its essential role in cellular metabolism . Comparative genomic studies have shown that while some functional gene clusters like one hup cluster, one shc gene, and the gvp cluster may be lost during genome reduction, genes essential for energy metabolism including nuoK are consistently retained . This pattern of conservation reflects the fundamental importance of respiratory chain components for bacterial survival.

What expression systems are most effective for recombinant nuoK production?

The most effective expression system documented for recombinant nuoK production is Escherichia coli . When designing expression systems for membrane proteins like nuoK, researchers should consider:

  • Vector selection: Vectors containing a His-tag fusion (typically N-terminal) facilitate purification while minimizing interference with protein folding and function .

  • Host strain selection: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results than standard strains.

  • Expression conditions: Reduced temperatures (16-20°C) and lower inducer concentrations frequently improve proper folding of membrane proteins like nuoK.

The documented approach using E. coli has successfully yielded purified recombinant nuoK protein with greater than 90% purity, making it suitable for various research applications .

How can factorial experimental designs optimize recombinant nuoK expression?

Factorial experimental designs offer a systematic approach to optimize multiple parameters simultaneously for recombinant nuoK expression. A properly designed factorial experiment should:

  • Identify key variables: For membrane protein expression, critical factors include temperature, inducer concentration, media composition, induction time, and host strain .

  • Structure the experiment: A 2ᵏ factorial design (where k is the number of factors) tests each factor at two levels. For example, a 2³ design investigating temperature (18°C vs. 30°C), IPTG concentration (0.1mM vs. 1.0mM), and host strain (BL21 vs. C41) would require 8 experimental conditions .

  • Analyze interactions: The true power of factorial design lies in revealing interactions between factors that might be missed in one-factor-at-a-time approaches .

RunTemperatureIPTG Conc.Host StrainYield (mg/L)
118°C (-)0.1mM (-)BL21 (-)X₁
230°C (+)0.1mM (-)BL21 (-)X₂
318°C (-)1.0mM (+)BL21 (-)X₃
430°C (+)1.0mM (+)BL21 (-)X₄
518°C (-)0.1mM (-)C41 (+)X₅
630°C (+)0.1mM (-)C41 (+)X₆
718°C (-)1.0mM (+)C41 (+)X₇
830°C (+)1.0mM (+)C41 (+)X₈

Statistical analysis of the results would identify main effects and interactions, providing a data-driven approach to optimize protein production .

What purification strategies yield the highest purity for recombinant nuoK protein?

Purification of membrane proteins like nuoK requires specialized approaches. Based on available data, the following strategy has yielded nuoK with >90% purity :

  • Initial preparation: The protein is expressed with an N-terminal His-tag to facilitate affinity purification .

  • Membrane protein extraction: Careful selection of detergents is critical for solubilizing membrane proteins without denaturation; mild detergents like n-dodecyl-β-D-maltoside (DDM) are commonly employed.

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin efficiently captures His-tagged nuoK protein.

  • Buffer optimization: The purified protein is maintained in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose, which helps stabilize the membrane protein .

  • Quality control: SDS-PAGE analysis confirms the final purity exceeds 90% .

This methodical approach ensures that the resulting purified protein maintains its structural integrity and is suitable for downstream applications.

How should recombinant nuoK be reconstituted and stored for maximum stability?

Proper handling of recombinant nuoK is essential for maintaining its structural integrity and functional activity. The recommended protocol includes:

  • Reconstitution procedure:

    • Centrifuge the lyophilized protein vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (preferably 50%) as a cryoprotectant

  • Storage conditions:

    • For long-term storage: Maintain at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

    • For working solutions: Store at 4°C for up to one week

    • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles which can destabilize membrane proteins

    • Monitor protein integrity after extended storage using analytical techniques such as SDS-PAGE

These handling procedures are specifically optimized for membrane proteins like nuoK and differ significantly from protocols for soluble proteins, highlighting the importance of specialized approaches for membrane protein research .

What analytical techniques are most effective for verifying nuoK structure and function?

Comprehensive characterization of recombinant nuoK requires multiple complementary analytical approaches:

  • Structural characterization:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content (expected to show high alpha-helical content characteristic of membrane proteins)

    • Size Exclusion Chromatography (SEC) to evaluate oligomeric state and homogeneity

    • Mass spectrometry for precise molecular weight determination and verification of the amino acid sequence

  • Functional analysis:

    • NADH oxidation assays to measure enzymatic activity

    • Reconstitution into proteoliposomes to assess membrane integration and potential proton translocation activity

    • Electron transfer experiments using artificial electron acceptors

  • Quality assessment:

    • SDS-PAGE confirms purity >90% as specified in the product information

    • Western blotting with anti-His antibodies verifies identity of the recombinant protein

    • N-terminal sequencing can confirm the intact N-terminus with the His-tag fusion

These analytical methods provide complementary information about both the structural integrity and functional capacity of the purified recombinant nuoK protein.

How can researchers distinguish between active and inactive forms of recombinant nuoK?

Assessing the activity of recombinant nuoK presents unique challenges as it typically functions as part of the larger NADH dehydrogenase complex. Researchers can employ the following strategies:

  • Biochemical activity assays:

    • Reconstitution with other purified complex I subunits to form functional subcomplexes

    • Measurement of NADH oxidation rates using spectrophotometric methods (monitoring absorbance at 340 nm)

    • Artificial electron acceptor assays using compounds like ferricyanide or decylubiquinone

  • Structural integrity assessment:

    • Thermostability assays to determine if the protein maintains its folded state

    • Limited proteolysis patterns compared to known active preparations

    • Binding studies with known interaction partners from the NADH dehydrogenase complex

  • Functional reconstitution:

    • Incorporation into liposomes to create a membrane environment

    • Measurement of proton translocation using pH-sensitive fluorescent dyes

    • Electron microscopy to verify proper membrane insertion and complex formation

These approaches collectively provide a comprehensive assessment of nuoK functionality beyond simple purity or structural analyses.

How do genomic characteristics of nuoK differ across Frankia strains?

Comparative genomic analysis reveals both conservation and variation in nuoK across different Frankia strains:

These findings illustrate the critical importance of energy metabolism components in Frankia evolution and adaptation.

What bioinformatic approaches best identify nuoK homologs in newly sequenced genomes?

Identification of nuoK homologs in newly sequenced Frankia genomes requires a multi-faceted bioinformatic approach:

  • Sequence-based methods:

    • BLAST searches using known nuoK sequences as queries

    • Profile Hidden Markov Models (HMMs) constructed from multiple sequence alignments of verified nuoK proteins

    • Position-Specific Scoring Matrices (PSSMs) to capture position-dependent amino acid preferences

  • Protein feature prediction:

    • Transmembrane domain prediction to identify the characteristic membrane-spanning regions of nuoK

    • Secondary structure prediction to detect the alpha-helical patterns typical of nuoK

    • Signal peptide and topology analysis to confirm membrane localization

  • Genomic context analysis:

    • Identification of conserved gene neighborhoods typical of the nuo operon

    • Synteny analysis to identify conserved gene order in respiratory chain complexes

    • Co-occurrence patterns with other NADH dehydrogenase subunits

  • Validation workflow:

    • Initial identification through sequence similarity

    • Filtering based on expected protein features (size, hydrophobicity, transmembrane domains)

    • Multiple sequence alignment to confirm conservation of functionally critical residues

    • Phylogenetic analysis to determine evolutionary relationships with known nuoK proteins

This systematic approach ensures reliable identification of genuine nuoK homologs while minimizing false positives.

What can nuoK sequence variations tell us about Frankia adaptation to different environments?

Analysis of nuoK sequence variations across Frankia strains provides insights into adaptive evolution:

  • Selective pressure analysis:

    • Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) can identify regions under positive or purifying selection

    • Transmembrane regions typically show stronger conservation than loop regions, reflecting functional constraints

  • Correlation with ecological niches:

    • Comparison of nuoK sequences from Frankia strains isolated from different host plants may reveal adaptations to specific symbiotic relationships

    • Strains from different geographical regions or soil conditions might show adaptive variations in respiratory chain components

  • Evidence from genome reduction:

    • The selective retention of respiratory chain components despite genome erosion in strains like AgB32 and AgKG'84/4 highlights the essential nature of energy metabolism genes

    • While these strains have lost multiple gene clusters (including one hup cluster, one shc gene, and the gvp cluster), the core respiratory chain machinery remains intact

  • Implications for metabolism:

    • Variations in nuoK might correlate with differences in energy efficiency, potentially affecting nitrogen fixation capacity

    • Adaption to different oxygen levels in various root nodule environments might drive specific variations in respiratory chain components

These evolutionary insights help explain how Frankia strains maintain essential metabolic functions while adapting to diverse environmental conditions.

How does nuoK function contribute to nitrogen fixation capabilities in Frankia?

While nuoK is not directly involved in nitrogen fixation, it plays a crucial supporting role through energy metabolism:

  • Energetic support:

    • Nitrogen fixation is an extremely energy-intensive process, requiring significant ATP input

    • As part of Complex I, nuoK contributes to proton translocation and thus ATP synthesis via oxidative phosphorylation

    • Efficient energy production is essential for sustaining the high energetic demands of nitrogen fixation

  • Relationship to symbiotic function:

    • Genomic analysis of Frankia strains AgB32 and AgKG'84/4 shows that all genes essential for symbiosis are present, including those for nitrogen fixation (nif), hydrogen uptake (hup), and Fe-S cluster assembly (suf)

    • These nitrogen-fixing capabilities depend on efficient energy metabolism provided by intact respiratory chains

    • The coordinated expression of respiratory chain components and nitrogen fixation genes is likely regulated to optimize energy utilization

  • Metabolic integration:

    • NADH generated during various metabolic processes is oxidized by Complex I (containing nuoK)

    • The resulting electron transfer and proton translocation drive ATP synthesis

    • This ATP then powers nitrogenase activity and other aspects of the symbiotic relationship

This metabolic integration highlights how nuoK indirectly but crucially supports Frankia's nitrogen-fixing capabilities.

What experimental approaches can link nuoK function to nitrogen fixation efficiency?

Several experimental approaches can establish connections between nuoK function and nitrogen fixation efficiency:

  • Genetic manipulation studies:

    • Site-directed mutagenesis of conserved nuoK residues to create variants with altered function

    • Expression of these variants in Frankia or model systems to assess effects on energy metabolism

    • Measurement of nitrogen fixation rates in strains expressing mutant nuoK proteins

  • Metabolic flux analysis:

    • Isotope labeling experiments to track carbon and nitrogen flow

    • Correlation of respiratory chain activity with nitrogen fixation rates

    • Metabolomic profiling to identify changes in metabolite pools related to energy production

  • Comparative physiological studies:

    • Analysis of Frankia strains with naturally occurring nuoK variants

    • Measurement of ATP/ADP ratios, membrane potential, and proton motive force

    • Correlation of these bioenergetic parameters with nitrogen fixation efficiency

  • Integrative omics approach:

    • Transcriptomic analysis to identify co-regulation of respiratory chain and nitrogen fixation genes

    • Proteomic studies to determine stoichiometry of respiratory complexes in nitrogen-fixing conditions

    • Systems biology modeling to predict how alterations in respiratory chain function impact nitrogen fixation

These approaches collectively provide a comprehensive understanding of how nuoK and energy metabolism influence nitrogen fixation capabilities in Frankia.

How can structural insights into nuoK inform engineering of enhanced nitrogen-fixing systems?

Structural knowledge of nuoK can inform bioengineering approaches for enhanced nitrogen fixation:

These applications represent the frontier of applied research in engineering enhanced nitrogen-fixing systems based on fundamental understanding of components like nuoK.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.