Recombinant Frankia sp. Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Introduction to Frankia and the CrcB Protein Family

Frankia species are filamentous, nitrogen-fixing bacteria that inhabit soil environments and establish symbiotic relationships with various woody angiosperms, collectively known as actinorhizal plants. These Gram-positive bacteria belong to the phylum Actinobacteria and are characterized by their distinctive growth pattern involving branching and tip extension, resembling the antibiotic-producing Streptomyces species . Frankia species produce three primary cell types during growth: sporangiospores, hyphae, and diazo-vesicles, with the latter specialized structures being responsible for supplying nitrogen to host plants during symbiotic relationships .

The CrcB protein family, to which CrcB homolog 2 belongs, is evolutionarily conserved across numerous bacterial species. While the specific function of CrcB homolog 2 in Frankia sp. has not been extensively characterized in the available research, related CrcB proteins in other bacterial species such as Staphylococcus aureus function as putative fluoride ion transporters, playing crucial roles in reducing cellular fluoride concentration and thereby mitigating potential fluoride toxicity . The presence of this protein family across diverse bacterial genera suggests conserved functional importance in cellular homeostasis.

Taxonomic Classification of Frankia

Frankia species are taxonomically positioned within the domain Bacteria, phylum Actinobacteria, class Actinobacteria, order Actinomycetales, suborder Frankineae, family Frankiaceae, and genus Frankia . This precise classification reflects their phylogenetic relationships and evolutionary history within the bacterial domain. The genus currently comprises several recognized species, with Frankia alni being among the most extensively studied representatives.

Ecological Significance of Frankia

Frankia bacteria demonstrate remarkable ecological importance through their nitrogen-fixing capabilities. Their symbiotic relationships with actinorhizal plants enable these host organisms to colonize and thrive in nitrogen-deficient environments including temperate forests, dry chaparral, sand dunes, and mine wastes . This symbiotic interaction contributes significantly to nitrogen cycling in various ecosystems. Except for Australia and Antarctica, Frankia species can be isolated from soils across all continents, highlighting their global distribution and ecological adaptability .

Primary Structure and Sequence Analysis

The CrcB homolog 2 protein from Frankia sp. strain CcI3 consists of a 147-amino acid sequence with the following primary structure: "MRRRQLRHAPVAVLLLAVISAGGAVGACARYGASLVWPTMPGTFPWTTWAVNTAGCAAIGVLMVLITDVRTVHPLVRPFLGTGVLGGFTTFSTYALDAQRLVDGGRTGLALAYLVLSVLAALGAVWAAAAAMRWFVARTRRVAGRRA" . This sequence is documented in protein databases with the UniProt accession number Q2JAK0 . The protein is encoded by the crcB2 gene, with the ordered locus name Francci3_2324, indicating its genomic context within the Frankia sp. strain CcI3 genome .

Hydrophobicity analysis of the amino acid sequence reveals multiple hydrophobic regions consistent with a transmembrane protein architecture. The presence of several hydrophobic amino acid stretches suggests that CrcB homolog 2 spans the cellular membrane multiple times, adopting a conformation that facilitates potential ion transport functions.

Post-translational Modifications

The recombinant production of CrcB homolog 2 may incorporate specific tag sequences to facilitate purification and detection, although the exact tag type is determined during the production process . These manufacturing-related modifications can influence protein behavior in experimental applications without substantially altering the protein's native functional characteristics.

Table 1: Key Molecular Characteristics of Recombinant Frankia sp. Protein CrcB homolog 2 (crcB2)

ParameterDetails
SpeciesFrankia sp. (strain CcI3)
UniProt AccessionQ2JAK0
Gene NamecrcB2
Locus NameFrancci3_2324
Sequence Length147 amino acids
Expression Region1-147
Molecular ClassTransmembrane protein
Recommended NameProtein CrcB homolog 2

Functional Analysis and Biological Role

The functional characteristics of CrcB homolog 2 in Frankia sp. can be inferred from comparative analysis with homologous proteins in other bacterial species, combined with contextual understanding of Frankia cellular physiology.

Proposed Functional Mechanisms

Based on homology with CrcB proteins in other bacterial species, particularly the well-characterized homolog in Staphylococcus aureus, the Frankia sp. CrcB homolog 2 likely functions as a fluoride ion transporter . In this capacity, the protein would facilitate the selective transport of fluoride ions across the cellular membrane, effectively reducing intracellular fluoride concentration and mitigating potential fluoride toxicity. This function is particularly relevant in soil environments where fluoride ions may be naturally present.

Physiological Context in Frankia

Within the broader physiological context of Frankia species, the CrcB homolog 2 protein likely contributes to cellular ion homeostasis and environmental adaptation. Frankia bacteria encounter diverse soil conditions during their lifecycle, including varying mineral compositions and potential exposure to toxic elements. The ability to effectively manage ion concentrations, particularly potentially harmful ions like fluoride, would represent an important adaptation for survival in these diverse microenvironments.

Recombinant Production and Biochemical Properties

The recombinant production of Frankia sp. Protein CrcB homolog 2 enables detailed biochemical characterization and application in research contexts.

Expression and Purification Systems

Recombinant CrcB homolog 2 is typically produced using cell-free expression systems that facilitate the generation of transmembrane proteins in functional conformations . These systems overcome the challenges associated with expressing membrane proteins in conventional cellular hosts, where toxicity or improper folding can limit yield and functionality.

The recombinant protein is available commercially in various quantities, typically starting from 50 μg with larger quantities available upon request . The production process incorporates appropriate tag sequences to facilitate purification, although the specific tag type may vary depending on manufacturing protocols and intended applications .

Biochemical Interactions

While specific interaction partners for Frankia sp. CrcB homolog 2 have not been extensively documented in the available literature, the protein likely interacts with various cellular components to fulfill its proposed ion transport functions. These interactions may include:

  1. Direct binding of fluoride ions for transport across cellular membranes

  2. Potential interactions with other membrane proteins to form functional complexes

  3. Possible associations with cytoplasmic proteins involved in ion homeostasis and detoxification pathways

Further biochemical studies would be required to definitively characterize these interaction networks and their functional significance in Frankia cellular physiology.

Applications in Research and Biotechnology

The recombinant Frankia sp. CrcB homolog 2 protein has various applications in research contexts, particularly in studies exploring bacterial membrane biology, ion transport, and Frankia physiology.

Analytical Applications

Recombinant CrcB homolog 2 can be utilized in various analytical applications, including Enzyme-Linked Immunosorbent Assays (ELISA) for detection and quantification purposes . These immunological approaches can facilitate studies of protein expression, localization, and abundance in different experimental contexts.

The availability of purified recombinant protein also enables structural studies using techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy, potentially providing detailed insights into the three-dimensional architecture of this transmembrane protein.

Functional Studies

Recombinant CrcB homolog 2 can be employed in functional studies investigating ion transport mechanisms and fluoride resistance in bacterial systems. These studies may utilize reconstituted membrane systems, ion flux measurements, or fluorescence-based assays to characterize transport kinetics and substrate specificity.

Additionally, the protein can serve as a standard in comparative studies examining CrcB protein function across different bacterial species, potentially highlighting evolutionary conservation and divergence within this protein family.

Biotechnological Potential

The biotechnological potential of CrcB homolog 2 and related proteins from Frankia species is supported by broader genomic analyses of these bacteria. Bioinformatic investigations have revealed significant natural product biosynthetic potential within Frankia genomes, with at least 65 biosynthetic gene clusters identified across different strains . These clusters encode for the production of diverse secondary metabolites, including cyclic peptides, siderophores, pigments, signaling molecules, and specialized lipids .

While CrcB homolog 2 specifically has not been directly implicated in these biosynthetic pathways, the rich metabolic diversity of Frankia species suggests potential applications in natural product discovery and biotechnological exploitation. The expression of significant and diverse secondary metabolic activity in laboratory cultures, as demonstrated by proteomic analyses, further supports this biotechnological potential .

Comparative Analysis with Related Proteins

Comparative analysis of Frankia sp. CrcB homolog 2 with related proteins in other bacterial species provides valuable insights into evolutionary conservation and functional significance.

Homology with Other CrcB Proteins

The CrcB homolog 2 protein in Frankia sp. shares sequence similarity with CrcB proteins found in various bacterial species. Notably, the CrcB homolog 2 in Staphylococcus aureus functions as a putative fluoride ion transporter, important for reducing fluoride concentration in the cell and mitigating toxicity . This functional annotation provides a basis for inferring similar roles for the Frankia protein.

Sequence alignment analysis would likely reveal conserved residues and domains crucial for the ion transport function, particularly within the transmembrane regions that form the ion channel structure. These conserved elements represent the functional core of the CrcB protein family that has been maintained through evolutionary history.

Evolutionary Context

The presence of CrcB homologs across diverse bacterial phyla suggests an ancient evolutionary origin for this protein family. The retention of these genes throughout bacterial evolution indicates their ongoing functional importance in cellular physiology, particularly in ion homeostasis and environmental adaptation.

Within the specific context of Frankia species, the crcB2 gene likely evolved in response to selective pressures related to soil habitat conditions and the establishment of symbiotic relationships with host plants. The genomic context of the crcB2 gene (Francci3_2324) may provide additional insights into its evolutionary history and functional associations within the Frankia genome.

Table 3: Comparison of CrcB Proteins Across Bacterial Species

SpeciesProtein NameUniProt IDProposed FunctionKey Features
Frankia sp. (strain CcI3)CrcB homolog 2Q2JAK0Putative fluoride ion transporter147 aa transmembrane protein
Staphylococcus aureusCrcB homolog 2Q6GFR9Fluoride ion transporterReduces cellular fluoride toxicity
Other bacterial speciesCrcB homologsVariousIon transport, detoxificationConserved transmembrane domains

Future Research Directions

Current understanding of Frankia sp. CrcB homolog 2 presents several promising avenues for future research investigation.

Functional Validation

Direct functional validation studies employing genetic manipulation approaches, such as gene knockout or overexpression in Frankia sp., would definitively establish the physiological roles of CrcB homolog 2 in vivo. These studies could examine impacts on fluoride sensitivity, ion homeostasis, and potentially symbiotic interactions with host plants.

Ecological and Symbiotic Relevance

Investigation of CrcB homolog 2 expression patterns during different growth phases and symbiotic states would clarify its relevance to Frankia ecology and symbiotic relationships. Potential differential expression during root nodule formation or nitrogen fixation would suggest specialized roles in these processes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
crcB2; Francci3_2324; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3)
Target Names
crcB2
Target Protein Sequence
MRRRQLRHAPVAVLLLAVISAGGAVGACARYGASLVWPTMPGTFPWTTWAVNTAGCAAIG VLMVLITDVRTVHPLVRPFLGTGVLGGFTTFSTYALDAQRLVDGGRTGLALAYLVLSVLA ALGAVWAAAAAMRWFVARTRRVAGRRA
Uniprot No.

Target Background

Function
CrcB2 plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxic effects.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key characteristics of Frankia sp. strain CcI3 where crcB2 is found?

Frankia sp. strain CcI3 (also referred to as HFPCcI3) is a narrow host range strain belonging to Frankia lineage Ib that forms nitrogen-fixing root nodule symbioses with plants in the Casuarinaceae family. Key characteristics include:

  • Genome size: 5.43 Mbp, which is smaller compared to medium and broad host range Frankia strains

  • G+C content: 70.0%

  • Host specificity: Primarily nodulates Casuarina cunninghamiana and C. equisetifolia, but not Allocasuarina species or other actinorhizal plants

  • Environmental distribution: Commonly found in nodules collected from casuarinas in Australia and areas where these trees have been planted as windbreaks or for erosion control

  • Symbiotic properties: Forms effective nitrogen-fixing nodules with optimal nodulation at pH 6-7 and temperature of 30-35°C

  • Morphological features: Filamentous growth with branching, occasional septations, and filament diameters averaging around 1 μm

The genome contraction observed in CcI3 compared to other Frankia strains is thought to reflect its adaptation to a more specialized host range .

What are the recommended protocols for recombinant expression and purification of Frankia crcB2?

For successful recombinant expression and purification of Frankia crcB2, the following methodological approach is recommended:

  • Expression System Selection:

    • Use E. coli as the preferred expression host due to its compatibility with Frankia proteins

    • Consider including a His-tag for efficient purification, typically at the N-terminus

  • Vector Construction:

    • Clone the full-length crcB2 gene (Francci3_2324) into an appropriate expression vector

    • Ensure the vector contains compatible promoters for regulated expression

  • Expression Conditions:

    • Induce protein expression under controlled conditions (temperature, media composition)

    • For membrane proteins like crcB2, lower expression temperatures (16-25°C) may improve proper folding

  • Purification Steps:

    • Lyse cells in an appropriate buffer compatible with membrane proteins

    • Perform affinity chromatography using the His-tag

    • Consider adding 6% trehalose to stabilize the protein structure

    • Purify to >90% purity as determined by SDS-PAGE

  • Storage and Reconstitution:

    • Store as a lyophilized powder at -20°C/-80°C

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (final concentration 50%) for long-term storage

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

This protocol is adapted from successful approaches used with similar Frankia proteins and takes into account the membrane-associated nature of crcB2 .

How can researchers verify the functional activity of recombinant crcB2 protein?

To verify the functional activity of recombinant crcB2 as a putative fluoride ion transporter, researchers should implement a multi-faceted approach:

  • Ion Transport Assays:

    • Use fluoride-selective electrodes to measure fluoride ion movement across membranes

    • Implement liposome reconstitution assays with purified crcB2 protein

    • Compare transport rates with positive and negative controls (e.g., known fluoride transporters and non-functional mutants)

  • Binding Assays:

    • Perform fluoride binding assays using isothermal titration calorimetry (ITC)

    • Conduct fluorescence-based assays with fluoride-sensitive probes

  • Structural Verification:

    • Use circular dichroism (CD) spectroscopy to confirm proper protein folding

    • Verify membrane insertion using proteoliposome floatation assays

  • Functional Complementation:

    • Test the ability of crcB2 to complement fluoride sensitivity in CrcB-deficient bacterial strains

    • Measure growth rates in media containing various fluoride concentrations

  • Mutagenesis Studies:

    • Create point mutations in conserved residues and assess their impact on function

    • Focus on residues in the transmembrane domains likely involved in ion coordination

This comprehensive approach provides multiple lines of evidence for functional verification and can help establish structure-function relationships for the crcB2 protein .

What experimental design is recommended for studying crcB2 expression in different Frankia growth conditions?

When studying crcB2 expression patterns under various growth conditions, a systematic experimental design should be implemented:

  • Experimental Variables:

    • Independent variable: Growth conditions (nitrogen availability, temperature, pH, salinity)

    • Dependent variable: crcB2 gene expression levels

    • Controlled variables: Media base composition, inoculum age/density, culture vessel type

  • Experimental Setup:

    Condition GroupVariables to TestControl GroupReplicates
    Nitrogen availability+N vs -N mediaStandard growth mediaMinimum 3 biological, 3 technical
    Temperature25°C, 30°C, 35°COptimal growth temperature (30°C)Minimum 3 biological, 3 technical
    pHpH 5.5, 6.5, 7.5Optimal pH (7.0)Minimum 3 biological, 3 technical
    Salinity0, 100, 200, 300 mM NaClNo added NaClMinimum 3 biological, 3 technical
    Symbiotic vs free-livingIn nodule vs in cultureFree-living cultureMinimum 3 biological, 3 technical
  • RNA Isolation Protocol:

    • Harvest cells at mid-logarithmic phase

    • Use specialized RNA extraction protocols optimized for actinobacteria

    • Treat samples with DNase to remove genomic DNA contamination

  • Expression Analysis Methods:

    • RT-qPCR using primers specific to crcB2

    • RNA-Seq for genome-wide expression context

    • Use multiple reference genes for normalization (gyrB, rpoD, and 16S rRNA)

  • Data Analysis:

    • Calculate relative expression using the 2^(-ΔΔCt) method

    • Perform ANOVA with post-hoc tests to determine significant differences

    • Create heat maps to visualize expression patterns across conditions

This experimental design allows for robust analysis of crcB2 expression patterns and addresses potential confounding variables while providing statistical power through appropriate replication .

How does crcB2 contribute to Frankia adaptation in different environmental conditions?

The crcB2 protein appears to play a significant role in Frankia adaptation to environmental stressors, particularly in managing ion homeostasis. Research indicates several key mechanisms:

  • Fluoride Tolerance:

    • As a putative fluoride ion transporter, crcB2 likely exports toxic fluoride ions from the cell, providing protection in fluoride-rich soils

    • This function may be particularly important in acidic soils where fluoride bioavailability increases

  • Symbiotic Adaptation:

    • Expression data shows that type IV restriction enzymes (including those related to crcB genes) are downregulated approximately 7.8-fold (p<0.007) during symbiosis compared to free-living conditions

    • This downregulation suggests a potential role in regulating horizontal gene transfer during symbiotic states

  • Host Range Determination:

    • Comparative genomics between narrow host range (Frankia sp. CcI3) and broad host range strains suggests that the expression patterns and structural variations of membrane proteins like crcB2 may contribute to host specificity

    • The protein may participate in signaling pathways or transport systems that influence host recognition

  • Stress Response:

    • Evidence suggests that crcB2 expression changes in response to environmental stressors, particularly salinity

    • Frankia sp. strain Allo2, which shows high salt tolerance, may utilize crcB2 as part of its adaptation mechanism

This multifaceted role of crcB2 highlights its importance in Frankia adaptation and survival in diverse ecological niches, from free-living soil bacteria to symbiotic root nodule inhabitants .

What are the challenges in developing a genetic transformation system for crcB2 modification in Frankia?

Developing a genetic transformation system for crcB2 modification in Frankia presents several significant challenges:

  • Restriction Enzyme Barriers:

    • Frankia expresses high levels of restriction enzymes, particularly type IV methyl-directed restriction enzymes that target methylated DNA

    • In Frankia alni ACN14a, three restriction enzyme genes are highly expressed: one type I enzyme (FRAAL4992, 92nd percentile), one type II enzyme (FRAAL0249, 91st percentile), and one type IV enzyme (FRAAL3325, 85th percentile)

    • These enzymes degrade foreign DNA, making transformation difficult

  • DNA Methylation Issues:

    • Actinobacteria, including Frankia, lack the dam methyltransferase gene used to mark parent DNA strands during replication

    • Type IV restriction enzymes in Frankia target methylated DNA, requiring unmethylated plasmids for transformation

  • Multicellular Hyphal Structure:

    • Frankia's multicellular hyphae require experiments to be performed on hyphal segments rather than individual cells

    • This complicates transformation procedures and selection of transformants

  • Low Homologous Recombination Rates:

    • Actinobacteria have low rates of homologous recombination due to competition between their homologous recombination pathway and a Non-Homologous End-Joining pathway

    • This makes targeted gene modifications difficult to achieve

  • Lack of Natural Vectors:

    • No Frankia phages have been discovered, limiting natural vectors for transformation

    • Previous attempts at plasmid integration were unstable, with the recombined plasmid lost in subsequent generations

To overcome these barriers, researchers have found success using unmethylated plasmids for electroporation, which circumvents the type IV restriction barrier. For crcB2 modification, a similar approach using unmethylated, broad host-range replicating plasmids with appropriate selection markers (like chloramphenicol-resistance) should be considered .

How do genome size variations in Frankia strains correlate with crcB homolog distribution and function?

Genome size variations in Frankia strains show fascinating correlations with crcB homolog distribution and functional adaptations:

  • Genome Size and Host Range Correlation:

    • Narrow host range strains (e.g., Frankia sp. HFPCcI3): 5.43 Mbp

    • Medium host range strains (e.g., Frankia alni ACN14a): 7.50 Mbp

    • Broad host range strains (e.g., Frankia sp. EAN1pec): 9.04 Mbp

  • Gene Distribution Patterns:

    Frankia StrainGenome SizeHost RangecrcB HomologsNotable Features
    Frankia sp. HFPCcI35.43 MbpNarrow (Casuarina)FewerOnly one siderophore gene cluster, lost one copy of shc gene
    Frankia alni ACN14a7.50 MbpMedium (Alnus)IntermediateTwo siderophore gene clusters, maintained duplicate copies of key genes
    Frankia sp. EAN1pec9.04 MbpBroad (Elaeagnus)MoreThree siderophore gene clusters, expanded gene families
  • Evolutionary Implications:

    • Genome contraction in narrow host range strains suggests gene deletion has occurred during adaptation to specialized host plants

    • The presence of fewer crcB homologs in narrow host range strains may reflect reduced need for diverse ion transport systems

    • Broad host range strains maintain more diverse gene families, including multiple crcB homologs, reflecting their need to adapt to various host environments

  • Functional Adaptations:

    • In narrow host range strains like CcI3, oxygen protection during nitrogen fixation is conferred by secondary plant cell walls rather than bacteriohopane synthesis

    • This has allowed for the loss of duplicated genes involved in vesicle development, including those potentially related to membrane protein function like crcB homologs

This pattern suggests that crcB homolog distribution has been shaped by the evolutionary history of Frankia strains and their adaptation to different host plants and environments. The concept of genome contraction in specialist strains versus expansion in generalist strains provides a fascinating model for bacterial adaptation .

How should researchers address contradictory findings when studying crcB2 function across different Frankia strains?

When confronted with contradictory findings regarding crcB2 function across different Frankia strains, researchers should implement a systematic approach:

  • Standardize Experimental Conditions:

    • Ensure consistent growth conditions, protein expression systems, and analytical methods

    • Create a standardized protocol for all strains being compared to minimize methodological variations

  • Consider Strain-Specific Adaptations:

    • Acknowledge that differences may reflect genuine biological variation rather than experimental artifacts

    • Analyze genomic contexts of crcB2 in each strain to identify potential regulatory or structural differences

  • Multi-method Verification:

    • Use multiple independent techniques to verify findings (e.g., combining in vitro assays with in vivo functional studies)

    • Employ both genetic approaches (gene knockout/complementation) and biochemical methods (protein activity assays)

  • Statistical Rigor:

    • Implement appropriate statistical analyses to determine if differences are significant

    • Use meta-analysis approaches when comparing results across multiple studies

  • Phylogenetic Framework:

    • Interpret contradictory results within a phylogenetic context of Frankia strains

    • Develop a hypothesis-based evolutionary model that could explain functional divergence

  • Collaboration Strategy:

    • Establish collaborative networks where multiple laboratories analyze the same strains

    • Create a centralized database for sharing raw data and detailed protocols

This structured approach helps distinguish genuine biological variation from methodological artifacts and can lead to deeper insights into how crcB2 function has evolved across different Frankia lineages .

What are the most appropriate bioinformatics tools for analyzing crcB2 sequence and structural features?

For comprehensive analysis of crcB2 sequence and structural features, researchers should utilize a specialized toolset:

  • Sequence Analysis Tools:

    • Multiple Sequence Alignment: MUSCLE or MAFFT for accurate alignment of crcB2 homologs

    • Phylogenetic Analysis: RAxML or MrBayes for evolutionary relationship inference

    • Conserved Domain Identification: InterProScan and NCBI CDD to identify functional domains

    • Transmembrane Topology Prediction: TMHMM, Phobius, or TOPCONS for membrane protein topology analysis

  • Structural Analysis Tools:

    • Protein Structure Prediction: AlphaFold2 or RoseTTAFold for generating high-confidence models

    • Molecular Dynamics Simulations: GROMACS or NAMD for membrane protein simulation in lipid environments

    • Structural Visualization: PyMOL or ChimeraX for visualization and analysis of predicted structures

    • Protein-Ligand Docking: AutoDock Vina for predicting fluoride ion binding sites

  • Functional Prediction Tools:

    • Transport Mechanism Analysis: Transporter Classification Database (TCDB) for functional classification

    • Ion Channel Analysis: CHANALYZER for ion channel/transporter specific analysis

    • Protein-Protein Interaction: STRING database to identify potential interaction partners

  • Comparative Genomics Tools:

    • Synteny Analysis: SyMAP or Mauve for examining genomic context of crcB2 across strains

    • Pan-genome Analysis: Roary or BPGA for comparing gene presence/absence across Frankia strains

    • Ortholog Identification: OrthoFinder for identifying true orthologs of crcB2

  • Data Integration Platforms:

    • Workflow Systems: Galaxy or Nextflow for reproducible analysis pipelines

    • Visualization Tools: Cytoscape for network analysis of functional relationships

This integrated bioinformatics approach provides comprehensive insights into crcB2 structure, function, and evolution across Frankia strains and related organisms .

How can researchers integrate transcriptomic and proteomic data to better understand crcB2 regulation in Frankia?

Integrating transcriptomic and proteomic data provides a comprehensive understanding of crcB2 regulation in Frankia. A methodological framework includes:

  • Experimental Design for Multi-omics:

    • Collect matched samples for both transcriptomics and proteomics

    • Include multiple conditions relevant to crcB2 function (nitrogen availability, symbiotic vs. free-living, stress conditions)

    • Implement appropriate replication (minimum 3 biological replicates)

  • Data Generation and Processing:

    • Transcriptomics: RNA-Seq with appropriate depth (30M reads per sample)

    • Proteomics: LC-MS/MS with attention to membrane protein extraction techniques

    • Data Processing: Standardized pipelines for quality control and normalization

  • Integration Methodologies:

    Integration ApproachToolsApplication to crcB2 Research
    Correlation AnalysisWGCNA, mixOmicsIdentify co-regulated genes and proteins with crcB2
    Pathway EnrichmentKEGG, GO enrichmentPlace crcB2 in broader biological pathways
    Network AnalysisSTRING, CytoscapeConstruct interaction networks centered on crcB2
    Causal ModelingBayesian networksInfer regulatory relationships affecting crcB2
  • Validation Strategies:

    • Targeted experiments to verify predicted regulatory relationships

    • ChIP-seq to identify transcription factors binding to crcB2 promoter

    • Reporter assays to validate promoter activity under different conditions

  • Interpretation Framework:

    • Compare transcript/protein ratios to identify post-transcriptional regulation

    • Analyze temporal dynamics to understand regulatory cascades

    • Consider strain-specific differences in regulation

This integrated approach has revealed that in Frankia alni ACN14a, type IV restriction enzymes are downregulated approximately 7.8-fold (p<0.007) during symbiosis compared to free-living conditions, suggesting potential regulatory connections to membrane proteins like crcB2 .

What statistical approaches are most appropriate for analyzing crcB2 expression data across different experimental conditions?

For robust analysis of crcB2 expression across experimental conditions, researchers should implement appropriate statistical methods:

  • Exploratory Data Analysis:

    • Assess data distribution using histograms and Q-Q plots

    • Check for outliers using box plots and Cook's distance

    • Evaluate sample relationships using principal component analysis (PCA)

  • Normalization Strategies:

    • For RT-qPCR: Use multiple reference genes (minimum 3) and apply geNorm or NormFinder

    • For RNA-Seq: Apply TMM, DESeq2, or quantile normalization methods

    • For proteomics: Use iBAQ or TOP3 normalization approaches

  • Statistical Testing Framework:

    Analysis GoalRecommended MethodsImplementation
    Differential ExpressionANOVA with post-hoc tests, Linear Mixed ModelsConsider nested designs for technical replicates
    Condition Comparisonst-tests with multiple testing correction (Benjamini-Hochberg)Apply when comparing specific pairs of conditions
    Time-series AnalysisEDGE, maSigProFor studying expression dynamics over time
    Multi-factor AnalysisTwo-way ANOVA, PERMANOVAWhen studying interaction effects (e.g., strain × condition)
  • Power Analysis:

    • Determine appropriate sample sizes based on pilot data

    • Calculate minimum fold changes detectable at given sample sizes

    • Consider biological relevance threshold alongside statistical significance

  • Visualization Approaches:

    • Use violin plots or box plots to show distribution differences

    • Implement heat maps for visualizing patterns across multiple conditions

    • Create volcano plots to highlight significant changes in expression

  • Advanced Analytical Methods:

    • Bayesian approaches for robust estimation with limited samples

    • Machine learning techniques for pattern discovery across complex datasets

    • Meta-analysis methods when combining data from multiple studies

What are the most promising research directions for understanding crcB2 function in plant-microbe interactions?

Future research on crcB2 in plant-microbe interactions should focus on several promising directions:

  • Signaling Role Investigation:

    • Explore whether crcB2 participates in signaling pathways during early recognition between Frankia and host plants

    • Develop fluorescently tagged crcB2 proteins to visualize localization during interaction stages

    • Investigate if crcB2 expression changes during different phases of nodule development

  • Host Specificity Mechanisms:

    • Compare crcB2 variants between narrow and broad host range Frankia strains

    • Create chimeric crcB2 proteins to identify domains responsible for host-specific functions

    • Test if crcB2 interacts with host-derived compounds or receptors

  • Metabolic Integration:

    • Investigate crcB2's role in nutrient and metabolite exchange during symbiosis

    • Study its potential involvement in adaptation to the microenvironment inside nodules

    • Examine connections between crcB2 function and nitrogen fixation efficiency

  • Stress Response Coordination:

    • Explore how crcB2 contributes to Frankia adaptation to osmotic, pH, and oxidative stress within nodules

    • Investigate cross-talk between crcB2 and plant stress response systems

    • Develop stress-tolerant strains through crcB2 engineering

  • Comparative Symbiosis Models:

    • Compare crcB2 function in Frankia-actinorhizal symbiosis with analogous systems in rhizobia-legume symbioses

    • Identify convergent or divergent evolutionary strategies in these symbiotic systems

    • Transfer insights between different plant-microbe symbiotic models

This research would contribute significantly to our understanding of actinorhizal symbioses and potentially lead to applications in sustainable agriculture by improving nitrogen fixation efficiency in non-leguminous plants .

How might CRISPR-Cas9 technology be adapted for targeted modification of crcB2 in Frankia sp.?

Adapting CRISPR-Cas9 technology for crcB2 modification in Frankia requires addressing several challenges specific to this organism:

  • Delivery System Design:

    • Develop unmethylated plasmid vectors to circumvent type IV restriction barriers

    • Optimize electroporation protocols specific to Frankia hyphal structure

    • Consider conjugation-based delivery systems using helper strains

  • CRISPR Component Adaptation:

    • Codon-optimize Cas9 for Frankia's high GC content (approximately 70%)

    • Use endogenous promoters from highly expressed Frankia genes to drive Cas9 expression

    • Design sgRNAs with high specificity for crcB2 while avoiding other genomic targets

  • Selection Strategy:

    • Implement a dual-selection system for both transformation and editing events

    • Consider counter-selection methods to identify cells that have lost the CRISPR plasmid after editing

    • Develop screenable phenotypes associated with crcB2 modification

  • Protocol Optimization:

    ComponentAdaptation for FrankiaRationale
    Cas9 variantUse smaller Cas9 orthologs or Cas12aEasier delivery and potentially lower toxicity
    TemperaturePerform editing at 25-30°COptimal for both Frankia growth and Cas9 activity
    Repair templateDesign with >1kb homology armsCompensate for low homologous recombination efficiency
    gRNA designTarget PAM sites in non-conserved regionsAllow specific modifications while maintaining function
  • Verification Methods:

    • Implement whole genome sequencing to confirm on-target editing and check for off-target effects

    • Develop PCR-based screening protocols to quickly identify successful edits

    • Validate phenotypic changes through appropriate functional assays

This adapted CRISPR-Cas9 system would open new possibilities for precise genetic manipulation of crcB2 and other genes in Frankia, advancing our understanding of their functions and potential applications .

What potential applications might emerge from engineering crcB2 for improved symbiotic nitrogen fixation?

Engineering crcB2 in Frankia could lead to several valuable applications for enhanced symbiotic nitrogen fixation:

  • Expanded Host Range:

    • Modify crcB2 to enable Frankia strains to nodulate non-traditional hosts

    • Create variant proteins based on broad host range strains to confer their capabilities to narrow host range strains

    • Potentially extend nitrogen-fixing symbiosis to economically important non-leguminous crops

  • Enhanced Stress Tolerance:

    • Engineer crcB2 variants with improved function under environmental stressors

    • Develop strains with enhanced salt tolerance for use in marginal or saline soils

    • Create acid-tolerant variants for improved performance in acidic soils

  • Improved Symbiotic Efficiency:

    • Optimize crcB2 expression levels to enhance nutrient exchange between Frankia and host plants

    • Engineer variants with improved ion transport capabilities to support nodule metabolism

    • Create feedback-insensitive variants that maintain activity under high nitrogen conditions

  • Agricultural Applications:

    • Develop biofertilizer formulations containing engineered Frankia strains

    • Create systems for establishing symbiosis with plantation forestry species

    • Use engineered strains for phytoremediation of contaminated soils

  • Bioenergy Applications:

    • Engineer symbiotic relationships with fast-growing woody plants for bioenergy production

    • Enhance nitrogen fixation efficiency to support sustainable biomass production

    • Develop systems requiring minimal external inputs for carbon-neutral energy production

These applications leverage the unique capabilities of Frankia and the actinorhizal symbiosis to address challenges in sustainable agriculture, environmental remediation, and renewable energy production. By engineering crcB2 and related proteins, researchers can potentially create more effective and adaptable symbiotic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.