Recombinant Frankia sp. Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol includes 50% glycerol. This serves as a reference for customer use.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
uppP1; Francci3_2402; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3)
Target Names
uppP1
Target Protein Sequence
MSSFSYAEAGVIGALQGATELFPVSSLGHSVLVPALIGGRWAADLDVSAPESPYLAFIVA VHVATAAALIVAFRDDWRRIITGLAVSVRDRRVTTADGRLAWLIILGTVPVGIVGLLLEH PLRTHLGRPLPAAVFLTVNGMIMLLGERLRRRSTTRGAPGPAGYRDEHTMPIPRSAPVTG RRVGTRPASGPLVAHGSAPGSGPGNHSKAVTTETALPEAEDVTLPEAETALPEAETAARH ADRRLAALPRLDALLVGVAQTAALAPGISRSGVTMIAGLSRGLSHLDAARFAFLLATPVI LAAGLLKLPDLLGPLGDGVRGQTLFGAIVAGVVAYVSIRFLARWFETRTATPFAVYCLVA GALCVVRFGIF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 1 (uppP1) and what is its function in bacterial cells?

Undecaprenyl-diphosphatase 1 (uppP1) is an enzyme (EC 3.6.1.27) involved in bacterial cell wall biosynthesis. It is also known as Bacitracin resistance protein 1 or Undecaprenyl pyrophosphate phosphatase 1. The enzyme plays a critical role in peptidoglycan synthesis by recycling the lipid carrier undecaprenyl phosphate. Specifically, it dephosphorylates undecaprenyl diphosphate to generate undecaprenyl phosphate, which is essential for the translocation of peptidoglycan precursors across the cytoplasmic membrane .

What are the optimal storage conditions for recombinant Frankia sp. uppP1?

For optimal stability and activity, recombinant Frankia sp. uppP1 should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage, conservation at -80°C is recommended. To maintain protein integrity, repeated freezing and thawing should be avoided. Working aliquots can be stored at 4°C for up to one week, but prolonged storage at this temperature is not recommended as it may lead to protein degradation and loss of enzymatic activity .

How can researchers design robust assays to measure uppP1 enzymatic activity?

A methodological approach to measuring uppP1 enzymatic activity involves:

  • Radioactive assay: Using radiolabeled substrates (typically ³²P-labeled undecaprenyl diphosphate) to directly measure dephosphorylation activity.

  • Pyrophosphate (PPi) release assay: Coupling the release of inorganic pyrophosphate to a colorimetric or fluorometric detection system.

  • Experimental design considerations:

    • Buffer optimization (typically pH 7.5-8.5)

    • Inclusion of divalent cations (Mg²⁺ or Mn²⁺)

    • Substrate concentration optimization

    • Detergent selection for this membrane-associated enzyme

    • Temperature control (usually 30-37°C)

  • Data analysis: Enzyme kinetics parameters (K<sub>m</sub>, V<sub>max</sub>) should be determined using appropriate models (Michaelis-Menten or allosteric models if applicable) .

How does uppP1 contribute to antibiotic resistance mechanisms in bacteria?

Undecaprenyl-diphosphatase 1 contributes to antibiotic resistance through several mechanisms:

  • Direct role in bacitracin resistance: uppP1 dephosphorylates undecaprenyl pyrophosphate to undecaprenyl phosphate, effectively bypassing the site of bacitracin action. Bacitracin binds to undecaprenyl pyrophosphate, preventing its recycling. Overexpression of uppP1 increases the flux through this pathway, reducing bacitracin efficacy.

  • Cell wall integrity maintenance: By ensuring efficient recycling of the lipid carrier, uppP1 maintains robust peptidoglycan synthesis even under antibiotic stress.

  • Synergy with other resistance mechanisms: In clinical isolates showing methicillin resistance (MRSA) or vancomycin resistance (VRE), uppP1 activity can work in conjunction with other resistance determinants to enhance survival .

The relationship between uppP1 activity and antibiotic susceptibility makes it a potential target for combination therapies aimed at overcoming resistance.

What approaches are being used to develop inhibitors targeting the undecaprenyl phosphate pathway?

Research on inhibitors targeting the undecaprenyl phosphate pathway involves several strategic approaches:

  • Structure-based virtual screening: Using crystal structures of related enzymes (UPPS) to identify potential inhibitors. This approach has successfully identified compounds with μM inhibitory activity against bacterial targets.

  • High-throughput screening: Testing large compound libraries against purified enzyme preparations to identify hit compounds.

  • Rational design of inhibitors: Based on known substrates and reaction mechanisms, designing compounds that mimic transition states.

  • Synergistic combinations: Developing compounds that can restore sensitivity to existing antibiotics like methicillin against MRSA or vancomycin against VRE.

Compound TypeIC₅₀ against UPPSMIC against Gram-positivesSynergy with existing antibiotics
Rhodanines1-10 μM0.43-2 μg/mLFICI = 0.11 with methicillin
Tetramic acids2-15 μM1-5 μg/mLFICI = 1-2 (indifferent)

These studies demonstrate the potential of targeting this pathway for antibiotic development, particularly in combination therapies against resistant bacteria .

How is uppP1 involved in heavy metal tolerance in Frankia species?

Studies on Frankia sp. strain EAN1pec have revealed that uppP1 plays a significant role in lead (Pb²⁺) tolerance mechanisms. The involvement occurs through several coordinated processes:

  • Surface modification: During Pb²⁺ exposure, Frankia upregulates uppP1 expression, which contributes to cell surface modifications that can bind and immobilize heavy metals.

  • Phosphate metabolism: As a phosphatase, uppP1 may contribute to the precipitation of lead as insoluble phosphate complexes at the cell surface.

  • Molecular response pathway: Proteomic analysis has shown that Pb²⁺ specifically induces changes in exopolysaccharides, triggers the stringent response, and activates the phosphate (pho) regulon, with uppP1 being part of this coordinated response.

  • Metal sequestration: In conjunction with other upregulated proteins like polyphosphate kinase and inorganic diphosphatase, uppP1 contributes to a system that exports and precipitates lead at the cell surface .

What analytical methods are most effective for studying uppP1-mediated metal interactions?

For comprehensive analysis of uppP1-mediated metal interactions, researchers should employ a multi-technique approach:

  • Scanning Electron Microscopy (SEM): To visualize morphological changes in bacterial surfaces following metal exposure.

  • Energy Dispersive X-ray Spectroscopy (EDAX): To quantify and map metal distribution on bacterial surfaces.

  • Fourier Transform Infrared Spectroscopy (FTIR): To characterize chemical modifications of surface components.

  • Proteomics approaches:

    • Labeled techniques (e.g., SILAC, iTRAQ)

    • Unlabeled shotgun proteomics

    • These methods can identify differential protein expression in response to metal exposure.

  • Transcriptomics: To correlate changes in gene expression with protein levels.

  • Isothermal Titration Calorimetry (ITC): To determine binding constants between purified uppP1 and metal ions.

  • X-ray Absorption Spectroscopy (XAS): For detailed analysis of the coordination environment of metals bound to uppP1.

These methodologies have successfully demonstrated that Frankia sp. strain EAN1pec binds significant quantities of Pb²⁺ through surface modifications that involve uppP1-dependent mechanisms .

How does Frankia sp. uppP1 compare structurally and functionally to homologs in other bacterial species?

Comparative analysis of uppP1 proteins from different bacterial species reveals important evolutionary and functional insights:

SpeciesProtein LengthSequence Similarity to Frankia sp.Notable Structural FeaturesFunctional Specialization
Frankia sp. (CcI3)371 aa100%Extended C-terminal regionHeavy metal tolerance
Burkholderia sp.276 aa~35%Shorter sequenceEnhanced membrane integration
E. coli~250 aa~30%Compact structureBasic cell wall synthesis
Bacillus species~270 aa~25-30%Variable regionsBacitracin resistance

Frankia sp. uppP1 contains distinctive sequence elements that may contribute to its specialized functions in heavy metal tolerance, while maintaining the core catalytic domains needed for undecaprenyl pyrophosphate dephosphorylation. These structural differences correspond to functional adaptations in different ecological niches .

What experimental designs are most appropriate for studying functional differences between uppP1 homologs?

To rigorously investigate functional differences between uppP1 homologs from different species, researchers should consider implementing:

  • Randomized Complete Block Design (RCBD): This design controls for experimental variation by grouping related experimental units into blocks.

    Example RCBD for testing catalytic efficiency of three uppP1 homologs:

    Block (Expression Batch)Frankia sp. uppP1Burkholderia sp. uppP1E. coli uppP1
    188 units93 units90 units
    290 units92 units92 units
    391 units96 units94 units

    This design allows for statistical analysis that separates treatment effects (different uppP1 homologs) from block effects (expression batch variations) .

  • Complementation studies: Using knockout strains to test functional complementation across species.

  • Site-directed mutagenesis: Systematically altering conserved residues to identify critical functional domains.

  • Chimeric protein construction: Creating fusion proteins between different homologs to map functional domains.

  • In vivo vs. in vitro correlation studies: Comparing enzymatic activities with cellular phenotypes such as antibiotic resistance or metal tolerance.

Analysis of variance (ANOVA) can be used to determine significant differences between homologs, with appropriate post-hoc tests (e.g., Tukey's HSD) to identify specific pairwise differences .

How can recombinant uppP1 be used in structural biology studies to facilitate drug discovery?

For structural biology applications aimed at drug discovery, researchers should consider the following methodological approach:

  • Protein production optimization:

    • Expression system selection (typically E. coli or insect cells)

    • Construct design with appropriate fusion tags (His, GST, MBP)

    • Solubilization strategies for this membrane-associated protein

    • Purification protocol development with detergent screening

  • Structural determination workflow:

    • Crystallization trials with various detergents and lipidic conditions

    • X-ray crystallography or cryo-EM structure determination

    • NMR studies for dynamic regions

    • Computational modeling to fill structural gaps

  • Structure-based drug design:

    • Virtual screening against determined structures

    • Fragment-based approaches

    • Structure-activity relationship development

    • Lead optimization using iterative structural analysis

  • Validation studies:

    • Enzymatic assays with potential inhibitors

    • Thermal shift assays to confirm binding

    • Isothermal titration calorimetry for binding energetics

    • Cellular validation in bacterial systems

This integrated approach has proven successful with related enzymes in the bacterial cell wall synthesis pathway, where structure-based virtual screening identified compounds with both enzymatic inhibition and antibacterial activity .

What are the current contradictions in the literature regarding uppP1 function and how might these be resolved?

Several contradictions exist in the current literature regarding uppP1 function:

  • Substrate specificity contradiction:

    • Some studies suggest high specificity for undecaprenyl pyrophosphate

    • Others report broader phosphatase activity against various substrates

    • Resolution approach: Conduct comprehensive kinetic studies using purified recombinant enzymes against a panel of substrates under standardized conditions

  • Cellular localization discrepancy:

    • Reported as primarily membrane-bound in some studies

    • Others suggest partial cytoplasmic distribution

    • Resolution approach: Implement cellular fractionation combined with fluorescent protein tagging and super-resolution microscopy

  • Metal dependency variation:

    • Requirements for Mg²⁺ vs. Mn²⁺ vs. Zn²⁺ differ across studies

    • Resolution approach: Systematic metal substitution experiments with careful control of metal contamination

  • Regulatory function debate:

    • Classical view: purely enzymatic role

    • Emerging evidence: potential regulatory functions

    • Resolution approach: Transcriptomics and proteomics of mutants with catalytically inactive versions of the enzyme

  • Physiological importance inconsistency:

    • Essential in some species but dispensable in others

    • Resolution approach: Comparative genomics combined with systematic gene knockout studies across bacterial species

To address these contradictions, researchers should implement balanced incomplete block designs when comparing multiple experimental variables, ensuring statistical rigor while managing experimental complexity .

What emerging technologies might enhance our understanding of uppP1 function?

Several cutting-edge technologies hold promise for advancing uppP1 research:

  • CRISPR-Cas9 genome editing: For precise manipulation of uppP1 genes in various bacterial species to study function in native contexts.

  • Single-molecule enzymology: To characterize the kinetic mechanisms of individual uppP1 molecules, revealing potential conformational changes during catalysis.

  • Cryo-electron tomography: For visualizing uppP1 distribution and organization within the bacterial cell envelope at near-atomic resolution.

  • AlphaFold2 and other AI-based structure prediction: To model uppP1 structures across species that have been challenging to crystallize.

  • Microfluidics-based high-throughput screening: For rapid identification of species-specific inhibitors.

  • Native mass spectrometry: To identify protein-protein interactions involving uppP1 within membrane complexes.

  • Specialized lipidomics: To comprehensively analyze the impact of uppP1 activity on bacterial membrane composition.

Integration of these technologies with experimental designs that control for biological variation will significantly advance our understanding of this important bacterial enzyme .

How might uppP1 function in complex microbial communities compared to laboratory monocultures?

The function of uppP1 in complex microbial communities likely differs from observations in laboratory monocultures in several important ways:

  • Interspecies signaling effects:

    • uppP1 activity may influence cell wall components that serve as microbe-associated molecular patterns (MAMPs)

    • These components could mediate interactions with other microbes in the community

  • Resource competition dynamics:

    • In competitive environments, efficient peptidoglycan recycling via uppP1 may provide fitness advantages

    • This effect would be masked in nutrient-rich laboratory media

  • Horizontal gene transfer considerations:

    • uppP1 variants with enhanced functionality may be subject to horizontal transfer in communities

    • This evolutionary pressure is absent in monocultures

  • Environmental stress responses:

    • Community living often involves fluctuating conditions that may affect uppP1 regulation

    • Metal ions or antibiotics at sub-inhibitory concentrations may induce uppP1 expression patterns not seen in laboratory conditions

  • Biofilm-specific functions:

    • Within biofilms, uppP1 may contribute to matrix production or structural integrity

    • These roles may be significant for community survival but negligible in planktonic culture

To investigate these differences, researchers should design experiments combining metatranscriptomics, metaproteomics, and in situ imaging techniques to observe uppP1 function within natural or reconstructed microbial communities .

What are common challenges in recombinant uppP1 expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant uppP1:

ChallengeCauseSolution Strategies
Low expression yieldMembrane protein toxicityUse tightly controlled induction systems; lower induction temperature (16-20°C); use specialized host strains (C41/C43)
Inclusion body formationProtein misfoldingAdd solubility enhancing tags (MBP, SUMO); optimize growth temperature; use specialized folding adjuvants
Poor solubilizationHydrophobic transmembrane regionsScreen detergent panel (DDM, LDAO, FC-12); consider nanodiscs or amphipols for native-like environment
Aggregation during purificationDetergent-protein mismatchInclude glycerol (10-20%) in all buffers; maintain detergent above CMC; consider size exclusion chromatography as final step
Loss of activityDenaturation during purificationIncorporate activity assays at each purification step; maintain reducing environment (1-5 mM DTT or 2-ME)
Protein heterogeneityDegradation or incomplete translationAdd protease inhibitors; optimize construct boundaries; consider C-terminal His-tag

Implementation of a systematic approach to optimization using design of experiments (DoE) methodology can efficiently identify optimal conditions while minimizing experimental runs .

How can researchers differentiate between true experimental effects and artifacts when studying uppP1?

To distinguish genuine experimental effects from artifacts when studying uppP1, researchers should implement the following methodological safeguards:

  • Rigorous experimental controls:

    • Catalytically inactive mutants (e.g., H/S mutation in active site)

    • Denatured enzyme controls

    • Buffer-only controls

    • Non-related membrane protein controls

  • Multiple detection methods:

    • Combine direct activity assays with orthogonal readouts

    • Use both continuous and endpoint measurements

    • Apply multiple visualization techniques for localization studies

  • Statistical design and analysis:

    • Randomized block designs to control for batch effects

    • Sufficient biological and technical replicates (minimum n=3)

    • Appropriate statistical tests with correction for multiple comparisons

    • Power analysis to ensure adequate sample size

  • Validation across systems:

    • Confirm key findings in different expression systems

    • Test in multiple bacterial species when possible

    • Compare recombinant protein results with native enzyme studies

  • Artifact-specific controls:

    • For metal binding studies: include EDTA-treated controls

    • For membrane association: compare detergent-solubilized vs. native membrane preparations

    • For inhibitor studies: include counterscreens for compound aggregation

By systematically addressing these considerations, researchers can significantly increase confidence in reported uppP1 functions and properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.