Recombinant Frankia sp. UPF0060 membrane protein Francci3_2786 (Francci3_2786)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Genomic Context

Francci3_2786 is part of a conserved gene cluster linked to cytokinin biosynthesis, a critical process in plant growth regulation. Key findings include:

Cytokinin Biosynthesis

  • Gene Cluster Composition: Francci3_2786 is associated with 11 conserved genes in Frankia genomes, including ipt (isopentenyl transferase), damt (dimethylallyl adenosine tRNA methylthiotransferase), and pde (phosphodiesterase), which collectively mediate cytokinin production .

  • Role in Symbiosis: The cluster includes a LysM domain, a signaling motif involved in plant-bacterium recognition, suggesting Francci3_2786 may facilitate host plant colonization .

Membrane Localization

As a membrane protein, Francci3_2786 may interact with extracellular ligands or participate in metallophore-mediated metal acquisition, though direct evidence remains limited .

Recombinant Expression

  • Host: E. coli (optimized for high yield)

  • Purification: Affinity chromatography via His-tag

  • Stability: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles

Research Applications

ApplicationDetailsSource
ELISAUsed as antigen in enzyme-linked immunosorbent assays for antibody detection
Protein Interaction StudiesInvestigates membrane protein dynamics in symbiosis or stress responses
Functional GenomicsValidates gene cluster roles in cytokinin synthesis and plant growth promotion

Genomic and Evolutionary Significance

  • Conservation: Francci3_2786 is present in multiple Frankia strains, indicating evolutionary importance .

  • Secondary Metabolism: Genomic analyses of Frankia spp. reveal additional biosynthetic clusters for metallophores and phytohormones, suggesting Francci3_2786 may interact with broader metabolic networks .

Table 2: Cytokinin Biosynthesis Gene Cluster Components

GeneFunctionRelevance to Francci3_2786
iptIsopentenyl transferaseCytokinin precursor synthesis
damttRNA methylthiotransferase2MeSiPR biosynthesis
pdePhosphodiesteraseiPR dephosphorylation
lysMLysM domain proteinPlant recognition signaling

Future Directions

  • Functional Validation: CRISPR-based knockouts in Frankia to confirm Francci3_2786’s role in cytokinin production .

  • Agricultural Applications: Leveraging recombinant Francci3_2786 to engineer plant growth-promoting biofertilizers .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
Francci3_2786; UPF0060 membrane protein Francci3_2786
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3)
Target Names
Francci3_2786
Target Protein Sequence
MGVVRSLLLFVVAAVTEIGGAWLVWQGVREHRGPVWVGLGIGFLAAYGFVATLQPDAHFG RILAAYGGVFVAGSLLWGVAVDGFRPDRYDLAGAAICLLGVAVIMYARRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the function of UPF0060 membrane proteins like Francci3_2786?

UPF0060 family proteins are classified as proteins of unknown function that localize to membranes. Current research indicates these proteins likely participate in membrane structure maintenance, transport functions, or signaling processes in Frankia species. Comparative analysis with peripheral membrane proteins suggests possible roles in temporary membrane binding at the interfacial area rather than full membrane insertion . Research approaches to determine function include gene knockout studies, protein-protein interaction assays, and comparative analysis with homologous proteins in related species.

How is Recombinant Francci3_2786 typically produced for research applications?

The recombinant protein is produced using E. coli expression systems with an N-terminal His-tag for purification purposes. The expression construct contains the full-length sequence (amino acids 1-110) of the native protein. Following expression, the protein is purified using affinity chromatography targeting the His-tag, which allows for high purity isolation (>90% as determined by SDS-PAGE) . The purified protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, optimizing stability during storage.

What experimental approaches are most effective for studying membrane protein-lipid interactions of Francci3_2786?

Several complementary approaches are recommended for investigating Francci3_2786 membrane interactions:

TechniqueApplicationKey Considerations
Surface Plasmon Resonance (SPR)Binding kinetics and affinity measurementsRequires proper reconstitution of the protein in lipid environments
Molecular Dynamics (MD) SimulationsStructural dynamics and lipid interactionsBoth implicit membrane models and all-atom simulations provide valuable insights
Coarse-Grained MDLonger timescale interactionsReduces computational load while maintaining essential physics
Fluorescence SpectroscopyReal-time binding studiesRequires fluorescent labeling that doesn't disrupt function
Cryo-EMStructural determination in membraneChallenging but provides native-like structural data

Based on studies of similar membrane proteins, a combination of computational approaches (such as implicit membrane modeling) with experimental validation (SPR spectroscopy) has proven particularly effective for characterizing membrane protein interactions . When designing these experiments, it's crucial to consider the membrane composition, as peripheral membrane proteins often show preferences for specific lipid compositions.

How can researchers distinguish between specific and non-specific membrane interactions when studying Francci3_2786?

To distinguish between specific and non-specific membrane interactions, researchers should implement multiple controls and comparative analyses:

  • Conduct binding studies with varying lipid compositions (neutral vs. anionic lipids)

  • Perform site-directed mutagenesis of putative membrane-interacting residues

  • Compare binding behaviors at different ionic strengths to isolate electrostatic contributions

  • Use competitive binding assays with known membrane-binding peptides

  • Apply computational analysis of hydrophobic patches and cation-π interactions

Research on peripheral membrane proteins shows that aromatic amino acids often play crucial roles in specific membrane interactions through cation-π interactions with lipid headgroups . Analyzing the Francci3_2786 sequence for aromatic residue clusters can help identify potential membrane-binding sites for targeted mutagenesis studies.

What are the challenges and solutions for structural studies of Francci3_2786?

Membrane proteins present unique structural biology challenges:

ChallengeSolution ApproachMethodological Considerations
Protein instabilityOptimize buffer conditionsTest detergents, lipid nanodiscs, and stabilizing agents
Low expression yieldsOptimize expression systemsTest different E. coli strains, expression conditions, and fusion partners
Aggregation issuesReconstitution methodsDialysis vs. direct reconstitution approaches
Structural determination difficultiesCombined methodologiesIntegrate X-ray crystallography, NMR, and computational modeling

When reconstituting Francci3_2786 for structural studies, researchers should follow specific protocols: centrifuge the vial prior to opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add glycerol (5-50% final concentration) for long-term storage . For membrane-based structural studies, consider membrane mimetics like nanodiscs or bicelles that better preserve native protein conformation than detergent micelles.

What are the optimal storage and handling conditions for maintaining Francci3_2786 activity?

For optimal maintenance of Francci3_2786 activity:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Perform aliquoting for multiple use to avoid repeated freeze-thaw cycles

  • Reconstituted working solutions can be stored at 4°C for up to one week

  • For long-term storage of reconstituted protein, add glycerol to 50% final concentration

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for storage

It's critical to avoid repeated freeze-thaw cycles as these significantly reduce protein activity. When reconstituting the protein, centrifugation prior to opening is recommended to bring contents to the bottom of the vial . For experimental reproducibility, maintain consistent handling procedures across studies and document any deviations in protocols.

How should researchers design control experiments when studying Francci3_2786 function?

Effective control experiments for Francci3_2786 functional studies should include:

  • Empty vector controls in expression systems

  • Heat-inactivated protein controls for enzymatic assays

  • Structurally similar but functionally distinct membrane proteins

  • Point mutants affecting key functional residues

  • Varying lipid compositions to test membrane specificity

When designing experiments to investigate potential functions, researchers should draw on knowledge from studies of peripheral membrane proteins and their binding mechanisms. For instance, comparative analysis with bacterial phospholipases has revealed how correlated motion in proteins affects enzymatic activity, which might inform experiments on Francci3_2786 . Additionally, control experiments should account for the influence of the His-tag on protein behavior, potentially including tag-cleaved protein versions as controls.

What reconstitution methods are most effective for incorporating Francci3_2786 into model membrane systems?

The effectiveness of reconstitution methods depends on the specific experimental goals:

Reconstitution MethodAdvantagesBest Applications
Direct incorporationSimple protocolBinding studies
Detergent dialysisHigh incorporation efficiencyFunctional assays
Lipid nanodiscsMaintains native environmentStructural studies
ProteoliposomesMimics cellular environmentTransport studies
Supported lipid bilayersCompatible with surface techniquesSPR, AFM studies

For reconstitution, initial solubilization in deionized sterile water to 0.1-1.0 mg/mL is recommended . The choice of lipid composition should consider the native bacterial membrane environment. For functional studies, a gradual detergent removal approach often yields the most homogeneous protein distribution in the membrane.

How should researchers interpret binding data for Francci3_2786 in different membrane compositions?

When analyzing binding data:

  • Compare binding parameters (Kd, kon, koff) across different lipid compositions

  • Evaluate the thermodynamic profile (ΔH, ΔS, ΔG) to distinguish enthalpy vs. entropy-driven binding

  • Analyze the role of electrostatic vs. hydrophobic interactions

  • Consider cooperative binding effects in multimeric assemblies

  • Integrate computational predictions with experimental results

Research on peripheral membrane proteins indicates that cation-π interactions at the membrane interface might represent an important anchoring mechanism . When interpreting Francci3_2786 binding data, examine the role of aromatic residues and their potential interactions with membrane components. Comparison with other UPF0060 family proteins can provide context for interpreting binding specificity and affinity measurements.

What statistical approaches are appropriate for analyzing variability in Francci3_2786 experimental data?

Appropriate statistical approaches include:

  • Power analysis to determine adequate sample sizes

  • ANOVA for comparing multiple experimental conditions

  • Regression analysis for binding kinetics

  • Bootstrap methods for estimating confidence intervals with limited samples

  • Bayesian approaches for integrating prior knowledge with experimental data

When reporting results, clearly state biological and technical replicates, and distinguish between different sources of variation. For binding studies, report both the mean and standard deviation of binding constants, and consider how experimental conditions might affect variability. Analysis of variance components can help identify whether variability stems from protein preparation, membrane composition, or measurement techniques.

How can researchers distinguish between functional and structural roles of Francci3_2786 in experimental data?

To distinguish functional and structural roles:

  • Perform time-resolved studies to capture dynamic processes

  • Couple structural studies with functional assays

  • Use structure-based mutagenesis to link specific motifs to functions

  • Compare wild-type protein with point mutants that maintain structure but alter function

  • Analyze co-localization with known functional complexes

Research approaches used for other membrane proteins, such as PR3 and bacterial phospholipases, demonstrate how combining computational and experimental studies can reveal both structural requirements for membrane binding and functional consequences of that binding . These approaches can be adapted for Francci3_2786 studies to distinguish structural features that enable membrane association from those that contribute to specific functions within the membrane environment.

What are the potential roles of Francci3_2786 in bacterial membrane organization and function?

Based on structural similarities with other bacterial membrane proteins, Francci3_2786 may participate in:

  • Membrane microdomain organization

  • Protein-protein interactions at the membrane interface

  • Signaling complex formation

  • Stress response mechanisms

  • Adaptation to environmental changes

Research approaches to explore these potential roles should include protein-protein interaction studies (pull-downs, crosslinking), localization studies using fluorescently tagged constructs, and phenotypic analysis of knockout or overexpression strains. The UPF0060 classification indicates knowledge gaps about this protein family that represent opportunities for novel discoveries about bacterial membrane biology .

How might recombination techniques be applied to study Francci3_2786 domain functions?

Recombination approaches offer powerful tools for studying domain functions:

TechniqueApplicationResearch Benefit
Domain swappingIdentify functional domainsMaps structure-function relationships
Chimeric proteinsTest domain transferabilityReveals conserved vs. species-specific functions
Directed evolutionEnhance specific propertiesDiscovers structure-function constraints
Synthetic recombinationCreate novel functionalitiesTests evolutionary hypotheses
Library screeningIdentify optimal variantsDiscovers key functional residues

When designing recombination experiments, researchers should consider the structural constraints of membrane proteins. Similar approaches used in studying recombinant viral proteins have successfully identified functional domains while maintaining protein stability . For Francci3_2786, domain swapping with other UPF0060 family members could reveal whether functional differences correlate with specific sequence regions.

What computational approaches best predict membrane integration and topology of Francci3_2786?

Computational prediction approaches should include:

  • Hydropathy analysis and transmembrane segment prediction

  • Molecular dynamics simulations with explicit membrane models

  • Analysis of conserved residues across UPF0060 family members

  • Integration of multiple prediction algorithms (consensus methods)

  • Energy minimization of alternative topological models

Research on peripheral membrane proteins has demonstrated the value of implicit membrane models (IMM1-GC), continuum electrostatics, and all-atom molecular dynamics in predicting membrane interactions . For Francci3_2786, computational predictions should be validated experimentally using techniques like protease protection assays, fluorescence resonance energy transfer (FRET), or site-directed spin labeling.

What methods are most effective for studying potential protein-protein interactions of Francci3_2786?

To study protein-protein interactions:

  • Co-immunoprecipitation with potential interaction partners

  • Yeast two-hybrid screening with membrane-adapted systems

  • Proximity labeling techniques (BioID, APEX)

  • Surface plasmon resonance with immobilized protein

  • Förster resonance energy transfer (FRET) in reconstituted systems

When designing these experiments, consider the membrane environment's impact on protein conformations and interactions. The His-tag present in the recombinant protein can be leveraged for pull-down assays, but researchers should verify that it doesn't interfere with potential interaction interfaces . Crosslinking approaches combined with mass spectrometry can identify transient interactions that might be missed by other techniques.

How can researchers assess the impact of environmental conditions on Francci3_2786 stability and function?

Environmental impact assessment should include:

  • Thermal stability assays across pH ranges

  • Chemical denaturation studies under various ionic conditions

  • Activity assays in the presence of potential inhibitors or activators

  • Membrane fluidity modulation experiments

  • Oxidative stress response testing

Given the recommended storage conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0) , researchers should systematically test deviations from these conditions to identify stability thresholds. For functional studies, consider environmental factors relevant to Frankia's native soil habitat, including variations in pH, temperature, and ion concentrations that might regulate protein activity.

What techniques are most appropriate for studying the dynamics of Francci3_2786 membrane interactions?

For studying membrane interaction dynamics:

TechniqueTemporal ResolutionInformation Provided
Stopped-flow fluorescenceMillisecondsInitial binding events
Hydrogen-deuterium exchangeMinutes to hoursConformational changes
NMR relaxation measurementsMicroseconds to secondsSite-specific dynamics
Single-molecule FRETMillisecondsIndividual molecule behaviors
Molecular dynamics simulationsNanoseconds to microsecondsAtomic-level motions

Research on peripheral membrane proteins has shown that cation-π interactions and aromatic amino acid insertion contribute significantly to membrane binding dynamics . For Francci3_2786, time-resolved studies should focus on identifying the sequence of events during membrane association, including initial recognition, insertion, and any subsequent conformational changes that might relate to function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.