Recombinant Fremyella diplosiphon Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Overview of Fremyella diplosiphon

Fremyella diplosiphon is a filamentous cyanobacterium known for its ability to adapt to varying light conditions through complementary chromatic adaptation. This organism serves as a model system for studying photosynthesis and light-regulated gene expression due to its unique pigment composition and environmental responsiveness . The Photosystem Q (B) protein is integral to the photosynthetic apparatus of Fremyella diplosiphon, specifically within Photosystem II.

Role in Photosynthesis

Photosystem Q (B), also known as the D1 protein or Photosystem II protein D1, is essential for the binding and reduction of plastoquinone molecules during the electron transport process. It forms part of the reaction center complex in Photosystem II, where it interacts with other proteins and cofactors to facilitate photochemical reactions .

Biochemical Properties of Recombinant Photosystem Q (B) Protein

Table 1: Amino Acid Sequence of Recombinant Fremyella diplosiphon Photosystem Q (B) Protein

PositionAmino Acid Sequence SegmentFunctional Annotation
1-50MTTTLQQRSRASVWDRFCEWITSTENRIYIGWFGVLMIPTLLAATACFVIAFIAAPPVDISignal peptide region
51-100DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLPlastoquinone binding site
101-150LGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTFCatalytic domain
151-344NFMIVFQAEHNILLHPFHmLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFGInteraction with cofactors

This sequence highlights critical regions involved in protein functionality, including plastoquinone binding and catalytic activity .

Physical Properties

The recombinant protein exhibits a molecular weight of approximately 32 kDa and is stable under specific storage conditions optimized for experimental use. It is typically stored in Tris-based buffer containing glycerol to maintain stability at low temperatures (-20°C or -80°C) .

Functional Characteristics

Functionally, the Recombinant Fremyella diplosiphon Photosystem Q (B) protein retains its ability to bind plastoquinone molecules and participate in electron transfer processes when expressed in vitro. This property makes it valuable for studying photosynthetic mechanisms .

Gene Encoding Photosystem Q (B) Protein

The gene encoding this protein is designated as psbA. It is highly conserved across cyanobacterial species and encodes the D1 protein required for Photosystem II function . The genetic sequence includes regulatory elements that ensure proper expression under varying environmental conditions.

Recombinant Expression Techniques

Recombinant expression of the Photosystem Q (B) protein involves cloning the psbA gene into suitable vectors followed by expression in host organisms such as Escherichia coli. The use of histidine tags facilitates purification through affinity chromatography . Table 2 outlines typical expression parameters.

Table 2: Expression Parameters for Recombinant Fremyella diplosiphon Photosystem Q (B) Protein

ParameterValue
Host OrganismEscherichia coli
Vector TypepET-based plasmid
Induction AgentIPTG
Purification MethodNi-NTA affinity chromatography

These methods ensure high yields and purity levels suitable for biochemical studies .

Biofuel Production

The role of Fremyella diplosiphon as a biodiesel-producing cyanobacterium has garnered interest due to its efficient photosynthetic machinery. The recombinant Photosystem Q (B) protein can be utilized to enhance light capture efficiency, thereby boosting biomass production .

Photoprotection Studies

Studies on photoinhibition mechanisms often employ recombinant proteins like Photosystem Q (B) to understand how environmental stress impacts photosynthetic efficiency . This research has implications for improving crop resilience under adverse conditions.

Drug Development

The structural insights gained from studying this recombinant protein can inform drug design targeting photosynthetic pathogens or enhancing photosynthesis in agricultural systems .

Stability Issues

Repeated freeze-thaw cycles can compromise the stability of recombinant proteins, necessitating optimized storage protocols . Future research should focus on developing more robust formulations.

Expanding Applications

While current applications are promising, further exploration into metabolic engineering using this recombinant protein could unlock new biotechnological opportunities.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
psbA; ps2B-1; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Microchaete diplosiphon (Fremyella diplosiphon)
Target Names
psbA
Target Protein Sequence
MTTTLQQRSRASVWDRFCEWITSTENRIYIGWFGVLMIPTLLAATACFVIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL LGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILLHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSVIDSQGRVIATWADVINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Fremyella diplosiphon Photosystem Q(B) protein and why is it important for photosynthesis research?

Fremyella diplosiphon Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein (EC=1.10.3.9), is encoded by the psbA gene (synonym: ps2B-1) and plays a crucial role in photosynthetic electron transport. This protein is particularly important for research because F. diplosiphon is a well-studied model cyanobacterium with efficient light absorption potential and pigment accumulation capabilities . The organism grows with a relatively short generation time of 8-10 days, making it ideal for various photosynthesis studies and allowing researchers to investigate fundamental aspects of light-harvesting mechanisms . As a key component of Photosystem II, the Q(B) protein facilitates electron transfer during the light-dependent reactions of photosynthesis, making it essential for understanding photosynthetic efficiency and energy conversion processes in cyanobacteria. Its study provides insights into both basic photosynthetic mechanisms and potential biotechnological applications in renewable energy.

What are the structural characteristics and sequence information of F. diplosiphon Photosystem Q(B) protein?

The Recombinant Fremyella diplosiphon Photosystem Q(B) protein (Uniprot NO: P07063) is a full-length protein containing 344 amino acids with a specific sequence that includes multiple transmembrane domains characteristic of thylakoid membrane proteins . The complete amino acid sequence begins with MTTTLQQRSRASVWDRFCEWITSTENRIYIGWFGVLMIPTLLAATACFVIAFIAAPPVDI and continues with multiple hydrophobic regions that anchor the protein within the thylakoid membrane . These hydrophobic domains are interspersed with hydrophilic regions that interact with the aqueous environments on either side of the membrane, creating a complex tertiary structure optimized for electron transport function. The protein contains conserved histidine residues that coordinate with cofactors involved in electron transfer, as well as specific binding sites for quinone molecules that serve as electron acceptors. Understanding these structural features is essential for researchers investigating structure-function relationships in photosynthetic proteins and for designing experiments to modify or enhance photosynthetic efficiency.

How does F. diplosiphon differ from other model organisms used in photosynthesis research?

Fremyella diplosiphon stands out among photosynthetic research organisms due to its remarkable adaptability to different light conditions and its efficient pigment accumulation mechanisms . Unlike many other cyanobacteria, F. diplosiphon exhibits increased fitness to grow across a broad spectrum of light conditions, allowing researchers to study photosynthetic adaptations under varying light qualities and intensities . The organism's relatively short generation time of 8-10 days makes it more practical for certain experimental timelines compared to slower-growing photosynthetic organisms. Additionally, F. diplosiphon has gained attention as a potential biodiesel-producing cyanobacterium, with studies showing that certain treatments like nanoscale zero-valent iron nanoparticles can boost its biomass production and lipid yield, presenting dual research interests in both fundamental photosynthesis and applied biofuel production . These distinctive characteristics make F. diplosiphon an increasingly valuable model for both basic photosynthetic research and applied biotechnological studies, offering advantages over traditional model organisms in specific research contexts.

What are the optimal storage conditions for Recombinant F. diplosiphon Photosystem Q(B) protein?

The optimal storage conditions for Recombinant Fremyella diplosiphon Photosystem Q(B) protein require careful attention to temperature, buffer composition, and handling procedures to maintain protein integrity and activity. Research-grade protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein's stability . For short-term storage up to one week, working aliquots can be maintained at 4°C, though this should be limited to amounts needed for immediate experiments to prevent repeated temperature cycling . For longer-term storage, the protein should be kept at -20°C, while extended storage periods necessitate conservation at either -20°C or preferably -80°C to minimize degradation and maintain structural integrity . Importantly, repeated freezing and thawing cycles should be strictly avoided as they can lead to protein denaturation, aggregation, and loss of activity; researchers should therefore prepare appropriately sized single-use aliquots upon receipt of the protein . These careful storage considerations are essential for preserving the functional characteristics of the protein and ensuring reproducible experimental results across multiple studies.

What methods are used to quantify reactive oxygen species (ROS) in F. diplosiphon in response to experimental treatments?

Several complementary methodologies are employed to quantify reactive oxygen species in Fremyella diplosiphon, providing researchers with comprehensive insights into oxidative stress responses under experimental conditions. The 2′,7′-dichlorodihydrofluorescein diacetate (DCFH-DA) fluorometric probe is a primary method used to detect intracellular ROS, offering high sensitivity for measuring oxidative stress in living cells . Additionally, lipid peroxidation measurement through the malondialdehyde and thiobarbituric acid-reactivity (MDA-TBA) assay serves as an indirect but reliable indicator of ROS-induced cellular damage, with studies showing MDA content ranging from 86.73 ± 9.7 to 165.50 ± 5.8 nmol mL⁻¹ in treated B481-WT strain and 128.46 ± 24 to 267.20 ± 26.23 nmol mL⁻¹ in B481-SD strain under various nZVI concentrations . Enzymatic responses to oxidative stress can be quantified through western blotting and immunodetection of iron superoxide dismutase (FeSOD), with densitometric analysis revealing significantly higher FeSOD levels in cultures treated with higher concentrations of stress-inducing compounds . Furthermore, transmission electron microscopy equipped with energy-dispersive X-ray spectroscopy (TEM-EDS) provides visual confirmation and elemental analysis of cellular interactions with experimental treatments, completing the multimodal approach to ROS characterization in this model organism .

How can researchers extract and analyze photosynthetic pigments from F. diplosiphon for experimental analysis?

Extraction and analysis of photosynthetic pigments from Fremyella diplosiphon requires a methodical approach to preserve pigment integrity while enabling accurate quantification. Researchers typically begin by harvesting cells during the exponential growth phase, centrifuging cultures at 8000 rpm for 15 minutes at 4°C to obtain cell pellets that are then either processed immediately or stored at -80°C to prevent pigment degradation . Pigment extraction is commonly performed using organic solvents such as methanol, acetone, or specialized extraction buffers, with cells being disrupted through sonication (100% amplitude, 10-second pulses with 1-minute cooling intervals) or mechanical homogenization in the presence of extraction solvent . Following extraction, cellular debris is removed by centrifugation at 10,000 rpm for 15 minutes at 4°C, and the supernatant containing pigments is collected for analysis by spectrophotometric methods or high-performance liquid chromatography (HPLC) . Spectrophotometric analysis allows for the determination of phycocyanin, phycoerythrin, allophycocyanin, and chlorophyll concentrations using specific wavelengths and established equations, while HPLC provides more detailed pigment profiles with greater specificity . For accurate quantification, standard curves should be prepared using purified pigments, and all procedures should be conducted under dim light conditions to prevent photodegradation of light-sensitive pigments.

How do antibiotics affect pigment accumulation and photosynthetic capacity in F. diplosiphon?

Research has revealed complex dose-dependent effects of antibiotics on Fremyella diplosiphon's pigment accumulation and photosynthetic capacity, with both stimulatory and inhibitory outcomes depending on concentration. Studies investigating the impact of ampicillin, tetracycline, kanamycin, and cefotaxime demonstrated that kanamycin at concentrations from 0.2 to 3.2 mg/L and tetracycline from 0.8 to 12.8 mg/L enhanced both growth and pigment accumulation in both B481-WT and B481-SD strains . Interestingly, the B481-SD strain treated with ampicillin at concentrations ranging from 0.2 to 51.2 mg/L exhibited significant enhancement of pigment fluorescence, suggesting strain-specific responses to certain antibiotics . In contrast, higher concentrations of antibiotics (6.4-102.5 mg/L kanamycin and 0.8-102.5 mg/L cefotaxime) demonstrated detrimental effects on growth and pigmentation in both strains, indicating a hormetic effect where low doses stimulate biological processes while higher doses become inhibitory . This research highlights the potential for using carefully calibrated antibiotic treatments to manipulate photosynthetic capacity and pigment production in cyanobacteria, with possible applications in biotechnology and bioenergy production where enhanced pigmentation or biomass is desired.

What are common challenges in working with recombinant photosystem proteins and how can they be addressed?

Working with recombinant photosystem proteins presents several technical challenges that researchers must navigate carefully to obtain reliable results. Protein stability is a primary concern, as photosystem proteins like the F. diplosiphon Photosystem Q(B) protein are membrane-associated and can rapidly denature when removed from their native lipid environment; this can be mitigated by using optimized storage buffers containing 50% glycerol and avoiding repeated freeze-thaw cycles . Maintaining the proper folding and functional state of the protein often requires specialized handling techniques, including performing experiments under dim green light to minimize photodamage and using appropriate detergents or lipid environments to preserve protein structure. Another significant challenge is achieving consistent activity in functional assays, which can be addressed by carefully controlling experimental conditions such as temperature, pH, and the presence of cofactors that may have been lost during purification . Additionally, researchers frequently encounter difficulties with protein aggregation during concentration steps, which can be minimized by adding stabilizing agents, using gentle mixing methods, and maintaining the protein at optimal temperatures throughout processing. Implementing these troubleshooting approaches requires careful optimization for each specific experimental system but ultimately enables more reliable and reproducible research with these challenging but scientifically valuable proteins.

How can researchers troubleshoot issues with oxidative stress measurements in F. diplosiphon experiments?

Accurate oxidative stress measurements in Fremyella diplosiphon require careful attention to potential methodological pitfalls and confounding factors that can affect experimental outcomes. When using fluorescent probes like DCFH-DA for ROS detection, researchers should be aware that background fluorescence from photosynthetic pigments can interfere with measurements; this can be addressed by including appropriate controls, optimizing excitation and emission wavelengths, and potentially using pigment extraction steps before analysis . For lipid peroxidation assays using the MDA-TBA method, inconsistent results might stem from variations in sample preparation or reaction conditions; standardizing cell disruption methods, maintaining strict temperature control during the heating step, and using internal standards can significantly improve reproducibility . When performing immunodetection of antioxidant enzymes like FeSOD, variable protein extraction efficiency between samples can skew results; this challenge can be overcome by normalizing to total protein content, using optimized extraction protocols with appropriate protease inhibitors, and confirming extraction efficiency across samples . Additionally, biological variability between cultures can be substantial, particularly when studying stress responses; increasing biological replicates (n≥3), carefully standardizing growth conditions, and harvesting cultures at identical growth phases can help minimize this variability . By implementing these troubleshooting approaches, researchers can obtain more reliable and biologically meaningful oxidative stress measurements in this important model organism.

What are the key considerations for experimental design when studying antibiotic effects on F. diplosiphon?

Designing robust experiments to investigate antibiotic effects on Fremyella diplosiphon requires careful consideration of multiple factors that can influence outcomes and interpretations. Concentration selection is critical, as research has demonstrated the hormetic effect where antibiotics like kanamycin (0.2-3.2 mg/L) and tetracycline (0.8-12.8 mg/L) can enhance growth and pigmentation at low concentrations while higher doses (6.4-102.5 mg/L kanamycin) prove detrimental—researchers should include a wide concentration range with close intervals to capture these nuanced dose-response relationships . Strain selection matters significantly, as studies revealed differential responses between B481-WT and B481-SD strains to identical antibiotic treatments, suggesting that multiple strains should be tested in parallel to identify strain-specific effects . Temporal considerations are equally important, with cellular responses to antibiotics evolving over time—experimental designs should include multiple time points, such as those revealing that maximum lactate dehydrogenase activity occurred at day 6 for 0.8 mg/L antibiotic treatments . Additionally, selecting appropriate endpoints is essential; comprehensive assessment should include growth parameters, pigment fluorescence quantification, reactive oxygen species detection, membrane permeability assessment, and microscopic evaluation of morphological changes like vacuolation and granule formation . By addressing these key considerations in experimental design, researchers can develop more comprehensive and accurate models of how antibiotics affect cyanobacterial physiology and photosynthetic capacity.

What are the potential mechanisms by which nZVIs influence lipid production in F. diplosiphon, and how might this be optimized for biofuel applications?

The mechanisms underlying nZVI-enhanced lipid production in Fremyella diplosiphon likely involve complex interactions between iron metabolism, oxidative stress responses, and lipid biosynthetic pathways that could be strategically optimized for biofuel applications. Research has established that nZVIs generate reactive oxygen species in F. diplosiphon through Fenton chemistry when zero-valent iron (Fe⁰) reacts with oxygen or water to release Fe²⁺, initiating oxidative stress signaling cascades . This controlled oxidative stress appears to trigger metabolic reprogramming that favors lipid accumulation, possibly as part of a stress response mechanism to sequester toxic compounds or prepare for adverse conditions. Mechanistically, nZVIs may influence carbon partitioning within the cell, directing photosynthetically fixed carbon toward lipid biosynthesis rather than protein production or cell division, particularly at concentrations that induce moderate stress without severely compromising cellular viability . For biofuel optimization, researchers could systematically investigate the relationship between nZVI-induced ROS levels and lipid production, potentially identifying an optimal "stress window" where lipid synthesis is maximized without compromising biomass accumulation. Additionally, combining nZVI treatment with genetic modifications targeting key regulatory elements in lipid biosynthetic pathways could create synergistic effects, further enhancing lipid productivity . Future research should also explore pulsed or gradient nZVI exposure protocols rather than constant concentration treatments, potentially mimicking natural environmental fluctuations that might trigger more pronounced lipid accumulation responses while minimizing cellular adaptation to chronic stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.