Recombinant Friend spleen focus-forming virus Glycoprotein 42 (env)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Friend spleen focus-forming virus (SFFV) Glycoprotein 42 (env), or gp42, is a mutated version of the envelope glycoprotein found in the Friend Spleen Focus-Forming Virus (SFFV) . SFFV is a retrovirus that induces rapid erythroleukemia in mice . The env gene of SFFV encodes a glycoprotein, typically gp55, which plays a crucial role in the virus's pathogenicity .

Background on SFFV and gp55

SFFV causes rapid erythroleukemia in mice because of its envelope glycoprotein, gp55 . Erythroid cells that express SFFV gp55 proliferate without erythropoietin (Epo), their normal regulator, due to constitutive activation of Epo signal transduction pathways . Although SFFV can infect various cell types, deregulation of cell growth happens only in erythroid cells, suggesting that these cells express unique proteins required by the virus to mediate its biological effects .

Development and Characteristics of gp42

The gp42 glycoprotein arises from mutations in the env gene of SFFV that lead to partial deletions . The mutant BB6, which encodes the gp42 glycoprotein, contains a large deletion in the membrane-proximal extracellular domain . The gp42 protein, similar to gp55, is processed inefficiently as a disulfide-bonded dimer to form a cell surface gp42p .

Functional Significance

  • Activation of Erythropoietin Receptor (EpoR): SFFV utilizes its env gene product to bind to erythropoietin receptors (EpoR) and stimulate erythroblastosis .

  • Mitogenic Signaling: The SFFV and BB6 env glycoproteins specifically activate EpoR .

  • Interaction with sf-Stk: SFFV gp55 interacts with a short form of the receptor tyrosine kinase Stk (sf-Stk). Expression of SFFV gp55 in rodent fibroblasts engineered to express sf-Stk induced their transformation, as demonstrated by focus formation and anchorage-independent growth in vitro .

  • Role in Host Resistance: The mitogenic effect of SFFV is blocked in mice homozygous for the Fv-2r resistance gene. Mutant SFFVs, like those encoding gp42, can overcome this resistance .

Research Findings

Research has shown that gp42, similar to gp55, can induce growth factor independency in BaF3/EpoR cells, which are derivatives containing recombinant EpoR . Studies using 125I-Epo to surface EpoR on these factor-independent cells, followed by the addition of a covalent cross-linking reagent, revealed complexes consisting of 125I-Epo-gp55p and 125I-Epo-gp42p in cell lysates .

Experiments indicate that SFFV gp55 may mediate its biological effects in vivo by interacting with and activating a truncated form of the receptor tyrosine kinase Stk .

Implications for Leukemia Research

The study of gp42 and its interaction with EpoR provides insights into the mechanisms of SFFV-induced erythroleukemia and the role of the EpoR-associated regulatory factors . Defining the glycoprotein properties important for EpoR activation helps to understand the function of the Fv-2 leukemia control gene, which may encode an EpoR-associated regulatory factor .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
env; Glycoprotein 42; gp42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-356
Protein Length
Full Length of Mature Protein
Species
Friend spleen focus-forming virus (strain BB6) (FSFFV)
Target Names
env
Target Protein Sequence
VQRDSPHQVFNVTWRVTNLMTGQTANATSLLGTMTDAFPKLYFDLCDLIGNDWDETRLGC RTPGEGKRARTFDLYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISLKR GNTPKDRGPCYDSSVSSGVQGATPGGRCNPLVLKFTDAGKKASWDAPKVWGLRLYRSTGT DPVTRFSLTRQVLNIGPRVPIGPNPVISDQLPPSRPAQIMLPRPPQPPPPGTASIVPETA PPSQQPGTRDRLLNLVNKAYQALNLTSPDKTQECWLCLVSRPPYYEGVAVLGTNSNHTTL ISTIMGLLIILLLLLILLLWTLHS
Uniprot No.

Target Background

Function
This envelope-like membrane glycoprotein is responsible for ligand-independent activation of the erythropoietin receptor (EPOR), leading to the abnormally rapid proliferation of erythroid precursor cells. In the initial phase of Friend disease, constitutive EPOR activation by gp42 causes uncontrolled polyclonal proliferation of infected erythroblasts, resulting in polycythemia (a significant increase in mature red blood cells). Host susceptibility to SSFV-induced erythroblastosis typically depends on the expression of the truncated MST1R receptor tyrosine kinase isoform (MST1R isoform sf-Stk); however, the BB6 deletion mutant can apparently circumvent its absence.
Subcellular Location
Host endoplasmic reticulum membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Virion membrane; Single-pass type I membrane protein.

Q&A

What is Friend spleen focus-forming virus (SFFV) and its glycoprotein 42?

Friend spleen focus-forming virus (SFFV) is a replication-defective murine leukemia virus that causes rapid transformation of specific hematopoietic target cells. It was first identified by Charlotte Friend in 1957 and is notable for causing erythroleukemia in susceptible mice. The glycoprotein 42 (gp42) is derived from the envelope (env) gene of SFFV. Molecular studies have revealed that SFFV is a recombinant between ecotropic murine type C virus (F-MuLV) and the env gene region of xenotropic type C virus . The acquisition of these xenotropic viral sequences is significant for understanding the rapid leukemogenicity of SFFV.

How does the genetic structure of SFFV gp42 differ from other retroviral envelope proteins?

SFFV gp42 differs from typical retroviral envelope proteins due to its recombinant nature. The env gene of SFFV contains sequences derived from xenotropic murine leukemia virus, while the remainder of the viral genome originates from ecotropic F-MuLV. Analyses using cDNA probes specific for xenotropic sequences (cDNASFFV) have demonstrated that these xenotropic elements are located within the env gene region, specifically in the portion encoding gp70, which is processed to form gp42 . This hybrid structure contributes to the unique pathogenic properties of SFFV, distinguishing it from both parental viruses.

What methodologies are commonly used to produce recombinant SFFV gp42 for research purposes?

Production of recombinant SFFV gp42 typically involves molecular cloning and expression systems. The process generally follows these steps:

  • PCR amplification of the env gene region from viral genomic DNA

  • Cloning into expression vectors (often vaccinia virus-based systems for mammalian expression)

  • Transfection into appropriate producer cells

  • Protein purification using affinity chromatography

For example, studies have constructed vaccinia-retrovirus recombinant vectors containing the env gene from Friend murine leukemia virus to study immune protection mechanisms . The recombinant protein is often expressed in a buffer containing 50% glycerol and stored at -20°C or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week .

How does SFFV gp42 contribute to viral entry and host cell specificity?

SFFV gp42 plays a crucial role in viral entry through its interaction with specific cell surface receptors. Similar to other retroviral envelope glycoproteins, it mediates attachment to target cells and facilitates membrane fusion. The recombinant nature of SFFV gp42, containing xenotropic virus env sequences, contributes to its altered host range and cell tropism compared to the ecotropic helper virus (F-MuLV).

The xenotropic env sequences in SFFV affect the binding specificity and fusion properties of the virus. Studies comparing SFFV with other recombinant retroviruses like Mo-MuLV83 have shown that acquisition of xenotropic env sequences confers altered host range properties . The exact mechanisms of receptor recognition by SFFV gp42 involve specific interactions with erythroid progenitor cell surface molecules, contributing to the characteristic erythroleukemia observed in infected mice.

What experimental models are most effective for studying SFFV gp42-mediated pathogenesis?

Several experimental models have proven effective for studying SFFV gp42-mediated pathogenesis:

  • In vivo mouse models: Newborn or adult mice (particularly NIH Swiss or BALB/c strains) injected with SFFV develop characteristic spleen foci and erythroleukemia. Key parameters measured include:

    • Spleen weight and morphology

    • Development of erythroleukemia (latency period typically 8-14 weeks)

    • Viral load in peripheral blood and tissues

  • Cell culture systems:

    • Friend virus-induced erythroleukemia cell lines

    • Primary erythroid progenitor cells

    • SC-1, BALB/c 3T3, and NIH 3T3 mouse embryo fibroblast cell lines

  • Recombinant virus systems: Engineered viruses with specific mutations or substitutions in the env gene allow for structure-function analysis of gp42. For example, researchers have created chimeric viruses by replacing portions of F-MuLV with FeLV sequences to study disease potential .

What analytical techniques are most reliable for confirming the identity and purity of recombinant SFFV gp42?

Multiple complementary techniques are recommended for confirming the identity and purity of recombinant SFFV gp42:

  • SDS-PAGE and Western blotting: Confirms the expected molecular weight (approximately 42 kDa) and antigenic properties using specific antibodies.

  • Mass spectrometry: Provides precise molecular weight determination and can verify the amino acid sequence through peptide mapping.

  • ELISA: Confirms antigenic properties and quantifies protein concentration.

  • Glycosylation analysis: Since gp42 is a glycoprotein, techniques such as lectin binding assays or glycosidase treatments followed by mobility shift analysis verify proper post-translational modifications.

  • Functional assays: Cell-binding assays or virus infection inhibition tests confirm biological activity.

For research applications, recombinant SFFV gp42 typically requires >95% purity, with verification of proper folding and glycosylation for experimental validity .

How do the structural differences between SFFV gp42 and other retroviral envelope glycoproteins correlate with their functional differences?

The structural differences between SFFV gp42 and other retroviral envelope glycoproteins are directly linked to their distinct functions. SFFV gp42 contains xenotropic virus-derived sequences within the env gene region that alter its structure-function relationship compared to the ecotropic F-MuLV envelope protein.

Key structural-functional correlations include:

Structural ElementOriginFunctional Impact
Receptor binding domainXenotropic MuLVAltered receptor specificity compared to ecotropic MuLV
Processing sitesHybridAberrant processing leading to distinct surface expression patterns
Transmembrane domainPrimarily ecotropicAffects membrane fusion and viral entry kinetics
N-glycosylation sitesHybridModified immune recognition and protein stability

Molecular hybridization studies using cDNASFFV (a probe detecting xenotropic sequences in SFFV) have demonstrated that these sequences are located in the 3' half of the genome, in a region approximately 3.5-4.5 kilobases from the 5' end, consistent with the env gene position . This recombination appears to be critical for the transforming properties of SFFV, as it alters interactions with host cell receptors and subsequent signaling pathways in hematopoietic progenitor cells.

What are the molecular mechanisms by which SFFV gp42 induces erythroleukemia, and how do they differ from other transforming retroviruses?

SFFV gp42 induces erythroleukemia through mechanisms distinct from other transforming retroviruses:

  • Receptor interaction: SFFV gp42 binds to and activates the erythropoietin receptor (EpoR), leading to constitutive signaling independent of erythropoietin. This contrasts with other transforming retroviruses that typically encode oncogenes or activate cellular proto-oncogenes through insertional mutagenesis.

  • Signal transduction: The interaction of gp42 with EpoR triggers multiple signaling pathways:

    • JAK/STAT pathway activation

    • PI3K/AKT pathway stimulation

    • MAPK pathway engagement

  • Transcription factor activation: These signaling events ultimately activate transcription factors that promote erythroid proliferation and block differentiation.

  • Immune evasion: The recombinant nature of SFFV gp42, containing xenotropic sequences, may contribute to immune evasion strategies that differ from typical ecotropic murine leukemia viruses.

How does the immune response to SFFV gp42 differ from responses to non-recombinant retroviral envelope proteins, and what implications does this have for vaccine development?

The immune response to SFFV gp42 differs significantly from responses to non-recombinant retroviral envelope proteins due to its hybrid nature:

  • Antibody responses: Studies using vaccinia-retrovirus recombinant vectors expressing the F-MuLV env gene have shown that immunized mice develop envelope-specific T-cell proliferative responses and, after challenge with Friend virus complex, produce neutralizing antibodies and cytotoxic T cells that provide protection against leukemia . This suggests that specific epitopes in SFFV gp42 are immunogenic and potentially useful for vaccine development.

  • T cell responses: Major histocompatibility complex (MHC) genes influence protection induced by vaccinia recombinants expressing F-MuLV env, but not protection induced by attenuated N-tropic Friend virus . This indicates that T cell recognition of envelope epitopes is critical for immunity.

  • Immune evasion: The xenotropic components of SFFV gp42 may contribute to immune evasion strategies, potentially through altered processing and presentation of viral antigens.

For vaccine development, these findings suggest that:

  • Targeting conserved epitopes shared between SFFV gp42 and F-MuLV env may provide cross-protection

  • Both humoral and cell-mediated immune responses are necessary for effective protection

  • Understanding the structural basis of protective epitopes could lead to rational vaccine design approaches

What are the current challenges and promising approaches in developing neutralizing antibodies against SFFV gp42?

Current challenges in developing neutralizing antibodies against SFFV gp42 include:

Promising approaches include:

  • Structure-based design: Lessons from EBV gp42 studies, where monoclonal antibodies like A10 and 4C12 revealed distinct sites of vulnerability, could be applied to SFFV gp42 . Crystallographic structures of antibody-antigen complexes can reveal critical neutralizing epitopes.

  • Recombinant immunogens: Expression of SFFV gp42 in vaccinia virus vectors has shown promise in eliciting protective immune responses . Further refinement of these immunogens could enhance neutralizing antibody production.

  • B cell repertoire analysis: Studying the B cell response in mice that successfully control SFFV infection could identify naturally occurring neutralizing antibodies for cloning and characterization.

  • Cross-reactive antibodies: Identifying antibodies that neutralize both SFFV and related retroviruses could reveal conserved vulnerable sites for targeting.

What are the most effective protocols for purifying recombinant SFFV gp42 while maintaining its native conformation?

Purifying recombinant SFFV gp42 while preserving its native conformation requires careful consideration of expression systems and purification methods:

  • Expression system selection:

    • Mammalian expression systems (particularly HEK293 or CHO cells) are preferred over bacterial systems to ensure proper glycosylation and folding

    • Inducible expression systems can help minimize toxicity and optimize protein quality

  • Affinity tag design:

    • Small tags (His6, FLAG) positioned at either terminus with optional protease cleavage sites

    • Tag position should be determined empirically to minimize interference with folding

  • Purification protocol:

    • Cell lysis under gentle conditions (low detergent concentrations)

    • Affinity chromatography using immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography as a polishing step and to confirm proper oligomeric state

    • All steps performed at 4°C with protease inhibitors

  • Buffer optimization:

    • Tris-based buffers with 50% glycerol have been reported for storing recombinant SFFV gp42

    • Addition of stabilizing agents such as low concentrations of non-ionic detergents or specific lipids may help maintain native conformation

  • Conformation verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to probe folded state

    • Functional binding assays to confirm receptor interaction capability

How can researchers effectively design structure-function studies to identify critical domains within SFFV gp42?

Designing effective structure-function studies for SFFV gp42 requires a systematic approach:

  • Sequence analysis and domain prediction:

    • Perform multiple sequence alignments with related viral envelope proteins

    • Identify conserved versus variable regions

    • Use bioinformatic tools to predict functional domains (signal peptides, transmembrane regions, receptor-binding domains)

  • Site-directed mutagenesis strategy:

    • Alanine-scanning mutagenesis of predicted functional regions

    • Charge-swap mutations to test electrostatic interactions

    • Conservative versus non-conservative substitutions to assess amino acid specificity

    • Domain swapping with related viral envelope proteins

  • Expression system optimization:

    • Vaccinia virus expression systems have been successfully used for F-MuLV env studies

    • Mammalian cell expression for proper post-translational modifications

    • Inducible expression systems for potentially toxic variants

  • Functional assays:

    • Receptor binding assays using purified receptors or receptor-expressing cells

    • Cell-cell fusion assays to assess membrane fusion capability

    • Viral infection assays using pseudotyped viruses

    • T-cell proliferation assays to assess immunogenicity of variants

  • Structural analysis integration:

    • When possible, correlate functional changes with structural information

    • Use homology modeling based on related viral glycoproteins like EBV gp42, where crystal structures have revealed binding sites and conformational changes

Studies with EBV gp42 have shown the value of this approach, revealing that the lectin-like domain of gp42 contains a hydrophobic pocket adjacent to the receptor binding site that is critical for fusion function .

What are the best experimental approaches for studying the interaction between SFFV gp42 and its cellular receptors?

Studying SFFV gp42-receptor interactions requires multiple complementary approaches:

  • Protein-protein interaction assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

    • Bio-layer interferometry as an alternative to SPR

    • ELISA-based binding assays for initial screening

    • Co-immunoprecipitation from cells expressing both proteins

  • Cellular binding assays:

    • Flow cytometry using labeled recombinant gp42 to quantify binding to receptor-expressing cells

    • Competitive binding assays with known ligands or antibodies

    • Cross-linking followed by mass spectrometry to identify interaction interfaces

  • Functional consequence assessment:

    • Cell signaling assays to measure receptor activation (phosphorylation, calcium flux)

    • Reporter gene assays linked to downstream signaling pathways

    • Cell proliferation and differentiation assays relevant to erythroleukemia development

  • Structural studies:

    • X-ray crystallography of gp42-receptor complexes (similar to EBV gp42-HLA studies )

    • Cryo-electron microscopy for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Mutagenesis approaches:

    • Alanine scanning of both gp42 and receptor proteins

    • Chimeric receptor proteins to map binding domains

    • Domain-swap experiments between related viral glycoproteins

Learning from EBV gp42 studies, where gp42 binds to HLA class II through its C-terminal lectin-like domain while the N-terminal region interacts with gH/gL , can provide a framework for understanding SFFV gp42 interactions.

How can researchers accurately assess the immunogenicity of recombinant SFFV gp42 in various animal models?

Accurately assessing SFFV gp42 immunogenicity requires comprehensive evaluation across multiple immune parameters:

  • Animal model selection:

    • Mice: The natural host for Friend virus offers the most relevant model

    • Strain considerations: Different mouse strains have varying susceptibility to Friend virus; studies show MHC genes influence protection induced by vaccinia recombinants expressing F-MuLV env

    • Age considerations: Newborn mice are more susceptible than adults

  • Immunization protocols:

    • Route: Intraperitoneal, intramuscular, and subcutaneous routes should be compared

    • Adjuvant selection: Test multiple adjuvant formulations

    • Prime-boost strategies: Homologous versus heterologous approaches

    • Dosing: Titration to determine minimum effective dose

  • Antibody response assessment:

    • ELISA for total binding antibodies

    • Neutralization assays using reporter viruses

    • Antibody isotype profiling (IgG1, IgG2a/c, IgM)

    • Avidity maturation measurement

    • Epitope mapping using peptide arrays or competition assays

  • T cell response evaluation:

    • ELISpot for IFN-γ, IL-2, and IL-4 to assess Th1/Th2 balance

    • Intracellular cytokine staining and flow cytometry

    • T cell proliferation assays using recombinant protein or peptide pools

    • Cytotoxic T lymphocyte (CTL) assays to measure killing of infected targets

  • Protection assessment:

    • Challenge with Friend virus complex

    • Measure viral load in blood and tissues

    • Monitor disease progression (splenomegaly, erythroleukemia)

    • Survival analysis

Evidence from vaccinia-retrovirus recombinant vector studies shows that mice immunized with these vectors develop envelope-specific T-cell responses and, after challenge, produce neutralizing antibodies and CTLs that protect against leukemia .

What methodological approaches are most suitable for studying the role of SFFV gp42 in viral entry and membrane fusion?

Studying SFFV gp42's role in viral entry and membrane fusion requires specialized techniques:

  • Pseudotyped virus systems:

    • Generate VSV or lentiviral particles pseudotyped with SFFV gp42

    • Include reporter genes (GFP, luciferase) for quantitative entry assays

    • Compare wild-type gp42 with mutant variants

  • Cell-cell fusion assays:

    • Split reporter systems (e.g., split luciferase) to quantify membrane fusion

    • Microscopy-based syncytia formation assays

    • Dye transfer assays to measure cytoplasmic mixing

  • Single virus tracking:

    • Fluorescently labeled virions for real-time imaging

    • Quantum dot-labeled particles for extended tracking

    • TIRF microscopy to visualize membrane-proximal events

  • Lipid mixing assays:

    • Fluorescently labeled viral membranes to distinguish hemifusion from full fusion

    • Liposome-based fusion assays with reconstituted proteins

  • Conformational change assessment:

    • Conformation-specific antibodies to detect pre- and post-fusion states

    • Limited proteolysis under various conditions

    • Fluorescence resonance energy transfer (FRET)-based sensors

Drawing parallels from EBV gp42 studies, where gp42 triggers membrane fusion after HLA binding through a process requiring simultaneous binding to gH/gL and a functional hydrophobic pocket in the lectin domain , could inform the design of experiments for SFFV gp42.

What are the most promising approaches for developing novel therapeutics targeting SFFV gp42?

Several promising approaches for developing therapeutics targeting SFFV gp42 include:

  • Neutralizing antibodies:

    • Monoclonal antibodies targeting critical epitopes on gp42

    • Antibody engineering to enhance neutralization potency

    • Bispecific antibodies targeting multiple viral components

    • Studies of EBV gp42-specific monoclonal antibodies (A10 and 4C12) have demonstrated protection against EBV infection and could serve as a model for SFFV therapeutic development

  • Entry inhibitors:

    • Peptide-based inhibitors derived from receptor binding regions

    • Small molecule inhibitors targeting the hydrophobic pocket (similar to the functional pocket identified in EBV gp42 )

    • Host receptor decoys or soluble receptor fragments

  • Gene therapy approaches:

    • CRISPR/Cas9 targeting of integrated proviruses

    • RNA interference targeting viral transcripts

    • Expression of dominant-negative gp42 variants

  • Combination approaches:

    • Targeting multiple steps in the viral life cycle

    • Combining entry inhibitors with reverse transcriptase inhibitors

    • Immunotherapy combined with direct-acting antivirals

  • Rational drug design:

    • Structure-based design of inhibitors based on crystal structures

    • Virtual screening of compound libraries against identified binding pockets

    • Fragment-based drug discovery approaches

The identification of sites of vulnerability on gp42, as demonstrated in EBV studies , provides a framework for developing similar therapeutic approaches against SFFV.

How might advanced structural biology techniques contribute to our understanding of SFFV gp42 function and immune recognition?

Advanced structural biology techniques offer significant potential for enhancing our understanding of SFFV gp42:

The lessons from structural studies of EBV gp42, which revealed a lectin-like domain containing a functional hydrophobic pocket adjacent to the receptor binding site , provide a roadmap for similar investigations of SFFV gp42.

How does the genetic diversity of SFFV gp42 impact vaccine design strategies?

The genetic diversity of SFFV gp42 presents both challenges and opportunities for vaccine design:

  • Diversity assessment approaches:

    • Next-generation sequencing of field isolates

    • Phylogenetic analysis to identify major variants

    • Epitope mapping across diverse strains

    • Structural analysis of variable regions

  • Conservative vaccine targets:

    • Identification of conserved epitopes through sequence alignment

    • Structural determination of conserved, functionally critical domains

    • Focus on regions essential for receptor binding or fusion

  • Polyvalent vaccine strategies:

    • Inclusion of multiple gp42 variants in a single formulation

    • Mosaic antigen design incorporating epitopes from diverse strains

    • Prime-boost strategies with different variants

  • Structure-based immunogen design:

    • Stabilization of conserved neutralizing epitopes

    • Masking of variable, non-neutralizing epitopes

    • Presentation of gp42 in its native trimeric form

  • Novel platform approaches:

    • Virus-like particles displaying gp42

    • mRNA vaccines encoding conserved gp42 domains

    • Viral vectors (similar to the vaccinia-retrovirus recombinant vectors studied for F-MuLV env )

Evidence from studies using vaccinia virus recombinants expressing F-MuLV env genes shows that immunized mice develop envelope-specific immune responses and are protected against Friend virus challenge , suggesting that despite diversity, effective immunization strategies are possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.