Recombinant Frog virus 3 Putative myristoylated protein 053R (FV3-053R)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Myristoylation

FV3-053R is a full-length recombinant protein (amino acids 2–522) expressed in E. coli with an N-terminal His-tag for purification . Key structural features include:

  • Myristoylation: The N-terminal glycine residue (position 1) is modified by a myristoyl group, critical for membrane binding .

  • Sequence Motifs: Contains conserved regions for myristoylation (G-X-X-X-S/T-X-X-X-) and potential hydrophobic pockets for ligand binding .

Table 2: Experimental Outcomes of 53R Inhibition

InterventionViral Titer ReductionCellular ObservationSource
Antisense Morpholino60%Reduced mature virions, dense granular bodies
Myristoylation Inhibitor80%Impaired membrane binding

Host-Virus Interactions

FV3-053R may modulate host immune responses, though direct evidence is limited. Indirectly, its role in virion assembly suggests involvement in evading host defenses, as defective assembly could trigger innate immune detection .

Genomic Context and Recombination

FV3-053R is part of the FV3 genome, which exhibits recombination with other ranaviruses (e.g., common midwife toad virus, CMTV) . While recombination breakpoints often involve core genes like the major capsid protein (MCP), FV3-053R remains conserved in most FV3 isolates, underscoring its evolutionary stability .

Research Applications

FV3-053R is utilized in:

  1. Viral Assembly Studies: To elucidate mechanisms of iridovirus replication .

  2. Vaccine Development: As a candidate antigen for ranavirus vaccines .

  3. Antiviral Drug Screening: Testing inhibitors targeting myristoylation or membrane interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FV3-053R; Putative myristoylated protein 053R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-522
Protein Length
Full Length of Mature Protein
Species
Frog virus 3 (isolate Goorha) (FV-3)
Target Names
FV3-053R
Target Protein Sequence
GAAESINTVNIVTKAYAKIMTTMVTDQDITADQSQVFSIDHVKGDVVIKGDVFTQMLVIN LASLMKAIATQSAQDQLIDNIAQQAQAAVSGLNLAQYAYVSNNIDRLITACVQMSTDMRV SCKSKVTMTQSFSVTDVEGDVRVTGVKFNQFANILSSCAMDASVNNDQARDIVSQIKQRG DAKASGLDPTTLIVIIVLVMVGAPMGAGFMAGRRAIGPLLASVGLIGGGAVALGYVPRPV KIEGFSSDPDFTLAQPAATVKGLTFTAAVAKLKSTDGYGALFWKNYDVKGTTAVKLQETL SYFAPAGYDPASWAGVGDSAPPFRIFPGLYQGKGDPGARPRAAYGYAGPVAGPKKGDAYL DGDTGSYYVLGDSWKMRGTISGHQNGRTDYWGTVDPTTTAALTGSERYIWVDPFTLVKST VWLFTGSPKKWTQQQTAPLDIPLTNTPSDFNVWVYKDDTAVQAVKWSSVGAGVAGAALTA SALLMPDSVASSEMSPAVGTGTPAIGTGSPAVGTGFPAHRG
Uniprot No.

Target Background

Function
Plays a critical role in virion formation and is essential for in vitro virus replication.
Database Links

KEGG: vg:2947832

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

What is FV3-053R and what is its functional significance in viral replication?

FV3-053R is a putative myristoylated membrane protein encoded by the Frog virus 3 (FV3) genome. Research has established that this protein is essential for viral replication in vitro. Experimental studies using antisense morpholino oligonucleotides targeting 53R demonstrated marked reductions in 53R protein levels and a corresponding 60% decrease in virus titers . Transmission electron microscopy revealed that cells with reduced 53R expression contained fewer mature virions and sometimes displayed dense granular bodies that may represent unencapsidated DNA-protein complexes .

Functionally, 53R localizes primarily within viral assembly sites, suggesting a critical role in virion formation. This hypothesis is further supported by experiments with myristoylation inhibitors (2-hydroxymyristic acid), which resulted in an 80% reduction in viral titers . These findings collectively indicate that 53R plays an essential role in the FV3 replication cycle, specifically in virion assembly and maturation.

How does myristoylation impact FV3-053R function and what methodologies can assess this modification?

Myristoylation is critical for FV3-053R function. Experimental evidence using myristoylation inhibitors (2-hydroxymyristic acid) demonstrated an 80% reduction in viral titers , indicating that this post-translational modification is essential for the protein's role in viral replication.

Methodological approaches to study myristoylation:

  • Pharmacological inhibition: Treatment with 2-hydroxymyristic acid can inhibit myristoylation. In previous studies, this approach resulted in significant reduction of viral titers (80%), comparable to the effects observed with direct knockdown of the protein .

  • Site-directed mutagenesis: Modifying the myristoylation motif (typically a glycine at position 2) can prevent myristoylation. This approach can be used to generate non-myristoylated mutants for comparative functional studies.

  • Metabolic labeling: Incorporating myristate analogs containing biotin or other detectable moieties can help track myristoylated proteins.

  • Subcellular localization studies: Comparing wild-type and myristoylation-deficient mutants using immunofluorescence microscopy can reveal how myristoylation affects protein localization to viral assembly sites.

Researchers should note that myristoylation appears to be critical for the correct localization of FV3-053R to viral assembly sites, which in turn is necessary for proper virion formation.

What detection methods are most effective for studying FV3-053R in experimental systems?

Several detection methods have proven effective for studying FV3-053R:

MethodApplicationSensitivityAdvantagesLimitations
ImmunofluorescenceLocalizationModerateVisualizes protein in cellular contextRequires specific antibodies
Western blottingExpression levelsHighQuantitative, size verificationCannot assess localization in situ
qPCRGene expressionVery highDetects low copy numbersMeasures mRNA, not protein
RPA-CRISPR/Cas12a-SPMViral detectionExtremely high (100 aM)Point-of-care capabilityMay detect fragmented viral DNA

A particularly sensitive detection system combines recombinase polymerase amplification (RPA) with CRISPR/Cas12a, achieving a limit of detection (LoD) of 100 aM (60.2 copies/μL) . This system has been further enhanced with smartphone microscopy implementation, lowering the LoD to 10 aM with results available in 40 minutes .

For in situ localization studies, immunofluorescence assays have confirmed that FV3-053R is found primarily within viral assembly sites . These methods are particularly valuable for studying the protein's role in virion formation.

How does FV3-053R differ among various viral strains and what are the implications for recombination events?

FV3-053R shows variation across different viral strains and isolates, which may have implications for virulence and host range. Genomic analyses have revealed that FV3 isolates display different patterns of recombination with other ranaviruses, particularly with common midwife toad virus (CMTV) .

Recombination patterns observed in FV3 genomes:

  • No recombination: Some FV3 isolates (KTC5, KTW1, Z377, Z582, Z595) showed no evidence of recombination in the region containing the 53R gene .

  • Single recombination event: Isolates like Z994 displayed a single recombination event .

  • Multiple recombination events: Isolates such as Z897, Z916, Z920, Z929, Z930, Z933, Z936, Z938, Z942, and Z939 showed two recombination events .

Most recombination breakpoints were located within open reading frames (ORFs), generating new ORFs and proteins that were a mixture between FV3 and CMTV . The FV3/CMTV ratio varied from 0 (entirely CMTV-like) to 0.98 (mostly FV3-like) .

A comprehensive study of FV3 genomic diversity demonstrated that different recombination patterns in the FV3-like population indicate that viruses with different genomic patterns are circulating in wild amphibian populations . This genetic diversity may influence the pathogenicity of different viral strains and should be considered when designing experimental systems to study FV3-053R.

Advanced Research Questions

What techniques are most effective for studying the role of FV3-053R in virion assembly?

To investigate FV3-053R's role in virion assembly, researchers have employed several complementary techniques:

  • Antisense morpholino oligonucleotide (AMO) knockdown: This approach has been successfully used to reduce 53R expression, resulting in a 60% drop in virus titers . The technique allows for temporal control over protein expression without permanently altering the viral genome.

  • Transmission electron microscopy (TEM): TEM analysis of cells with reduced 53R expression revealed fewer mature virions and, in some cells, dense granular bodies that may represent unencapsidated DNA-protein complexes . This technique provides direct visualization of virion assembly defects.

  • Myristoylation inhibitors: Treatment with 2-hydroxymyristic acid resulted in an 80% reduction in viral titers , suggesting that myristoylation is critical for 53R function in virion assembly.

  • Immunofluorescence co-localization: This technique can be used to demonstrate the presence of 53R within viral assembly sites and its co-localization with other virion components .

  • Recombinant protein interaction assays: Using purified recombinant 53R protein, researchers can identify interaction partners among other viral structural proteins using techniques such as pull-down assays, co-immunoprecipitation, or surface plasmon resonance.

A multifaceted approach combining these techniques can provide comprehensive insights into how 53R contributes to virion assembly. The visualization of incomplete virion formation in 53R-depleted cells strongly supports its essential role in this process.

How do FV3-053R recombinants impact viral pathogenicity and host range?

Genomic analyses have revealed extensive recombination in wild amphibian populations, with significant implications for viral pathogenicity. Recombinants between FV3 and CMTV have been reported to have higher pathogenicity than parental strains .

Key findings on recombination and pathogenicity:

  • Recombination patterns: FV3 isolates display different recombination patterns with CMTV-like viruses, varying from no recombination to multiple recombination events .

  • Mosaic proteins: Some ORFs, including potentially 53R depending on the isolate, became mosaics between FV3 and CMTV due to recombination events within the coding regions .

  • Impact on virulence: In virulence studies with Lithiobates pipiens tadpoles, different FV3 strains showed variable pathogenicity:

FV3 StrainSurvival Rate (41 days post-infection)Notes
SSMEApproximately 70%Least virulent; has multiple amino acid deletions
wt-FV3Approximately 40%Intermediate virulence
aza-CrApproximately 35%Most virulent in this comparison

These differences in pathogenicity correlated with genomic variations, including deletions in ORFs 49/50L, 65L, 66L, and 87L in the less virulent SSME strain .

The presence of CMTV-derived genes associated with virulence in wild FV3 strains in Canada suggests that recombination events can enhance pathogenicity . This has significant implications for amphibian conservation efforts and underscores the importance of surveillance for emergent recombinant viral strains.

What are the methodological challenges in developing gene editing approaches for studying FV3-053R function?

Developing effective gene editing approaches for studying FV3-053R function presents several methodological challenges:

  • Double-stranded DNA virus complexity: As a large double-stranded DNA virus, FV3 presents challenges for standard gene editing techniques. The viral genome is approximately 105 kb in size and contains around 98 potential open reading frames .

  • Essential gene targeting: Since 53R is essential for viral replication , complete knockout would be lethal to the virus, making it difficult to generate viable mutants for functional studies.

  • Temporal expression patterns: FV3 genes are temporally regulated (immediate-early, delayed-early, or late genes) . Understanding 53R's temporal expression pattern is crucial for designing effective targeting strategies.

  • Complementation systems: To study essential genes like 53R, conditional expression systems or complementation approaches are needed:

    • Antisense morpholino oligonucleotides have proven effective for transient knockdown

    • Inducible expression systems in complementing cell lines could maintain viral replication while studying mutant phenotypes

  • Validation challenges: Confirming specific targeting of 53R without off-target effects requires careful validation using techniques such as:

    • Western blotting to confirm protein reduction

    • RT-PCR to assess transcription levels

    • Next-generation sequencing to verify genomic modifications

  • Host system limitations: FV3 studies are often conducted in amphibian cell lines or primary cells, which may have limited tools available compared to mammalian systems.

A promising approach is the use of recombinase polymerase amplification (RPA) combined with CRISPR/Cas12a systems, which have been successfully used for FV3 detection with high sensitivity (100 aM or 60.2 copies/μL) . Adapting these systems for gene editing purposes could provide new opportunities for studying 53R function.

How does inflammation affect FV3-053R expression and viral reactivation in asymptomatic carriers?

Inflammation can trigger reactivation of latent FV3 infection, with implications for 53R expression and viral pathogenesis. Studies examining inflammation-induced reactivation of FV3 provide important insights:

  • Bacterial co-infection model: Experiments using FV3 followed by E. coli infection demonstrated significant viral reactivation:

TreatmentPCR DetectionRT-PCR DetectionSigns of InfectionMortality Rate
FV3 + E. coli28/45 (62%)25/45 (56%)13/45 (29%)16/45 (36%)
FV3 only9/50 (18%)6/50 (12%)3/50 (6%)4/50 (8%)

This data demonstrates that inflammatory stimuli significantly increase both viral detection rates and mortality in previously infected animals .

  • Viral reactivation mechanism: During reactivation, viral gene expression including 53R is upregulated. Since 53R is essential for virion formation , its expression level during reactivation is likely critical for productive infection.

  • Methodological approaches: Studying inflammation-induced reactivation requires:

    • PCR detection of viral DNA to identify presence of viral genome

    • RT-PCR to confirm active viral transcription (including 53R)

    • Clinical assessment to correlate molecular findings with disease manifestation

    • Immunological assays to characterize the inflammatory response

These findings have important implications for understanding FV3 persistence in wild amphibian populations, where environmental stressors or secondary infections might trigger viral reactivation through inflammatory pathways. The role of 53R in this reactivation process represents an important area for future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.