Recombinant Frog virus 3 Uncharacterized protein 010R (FV3-010R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FV3-010R; Uncharacterized protein 010R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Frog virus 3 (isolate Goorha) (FV-3)
Target Names
FV3-010R
Target Protein Sequence
MKMDTDCRHWIVLASVPVLTVLAFKGEGALALAGLLVMAAVAMYRDRTEKKYSAARAPSP IAGHKTAYVTDPSAFAAGTVPVYPAPSNMGSDRFEGWVGGVLTGVGSSHLDHRKFAERQL VDRREKMVGYGWTKSFF
Uniprot No.

Target Background

Database Links

KEGG: vg:2947782

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

Overview

Frog virus 3 (FV3) is a widespread ranavirus associated with amphibian mortality and population declines across continents. The uncharacterized protein 010R (FV3-010R) represents one of several proteins in the FV3 genome whose function remains to be fully elucidated. This collection of frequently asked questions aims to address common inquiries from researchers investigating this protein, from basic characterization to advanced functional studies.

How does FV3-010R fit into the broader context of the FV3 genome?

FV3-010R is one of several uncharacterized proteins in the FV3 genome. The FV3 genome contains multiple open reading frames (ORFs), many of which have unknown functions. FV3 belongs to the Ranavirus genus within the Iridoviridae family, which includes double-stranded DNA viruses capable of infecting amphibians, reptiles, and bony fishes . Genome sequencing studies have revealed recombination events between FV3 and other ranaviruses, particularly Common midwife toad virus (CMTV), which may affect virulence and pathogenicity .

What approaches are recommended for initial characterization of an uncharacterized viral protein like FV3-010R?

For initial characterization, a multi-pronged approach is recommended:

  • Sequence analysis: Perform comparative sequence analysis using tools like BLAST to identify homologs and conserved domains.

  • Structural prediction: Use servers like Swiss-Model and D-I-TASSER to predict tertiary structure .

  • Subcellular localization prediction: Employ tools such as CELLO, PSORTb, and PSLpred to predict cellular localization .

  • Physicochemical characterization: Determine basic properties including molecular weight, isoelectric point, and stability.

  • Expression analysis: Quantify expression levels during different stages of viral infection to infer potential functional importance.

  • Preliminary functional assays: Conduct binding assays with host proteins and nucleic acids to identify potential interaction partners.

What are optimal conditions for expressing and purifying recombinant FV3-010R protein?

For optimal expression and purification:

  • Expression system: E. coli has been successfully used with an N-terminal His-tag fusion .

  • Expression conditions:

    • Induction with IPTG (typically 0.5-1.0 mM)

    • Post-induction temperature of 18-25°C to maximize soluble protein yield

    • Incubation period of 4-16 hours

  • Purification protocol:

    • Lysis in Tris/PBS-based buffer containing protease inhibitors

    • Affinity chromatography using Ni-NTA resin

    • Optional secondary purification step (ion exchange or size exclusion)

    • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Long-term storage at -20°C/-80°C in buffer containing 50% glycerol

How should researchers design experiments to investigate potential functions of FV3-010R?

A systematic approach includes:

  • Knockout/knockdown studies: Generate FV3 virions lacking the 010R gene or with reduced expression to observe phenotypic effects on viral replication and pathogenicity.

  • Overexpression studies: Express FV3-010R in host cells to observe cellular effects and potential localization patterns.

  • Protein-protein interaction assays:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with host cell lysates

    • Pull-down assays

    • Biolayer interferometry or surface plasmon resonance

  • Transcriptomics approach: Compare host gene expression profiles between cells infected with wild-type FV3 versus FV3 lacking 010R.

  • Structural biology techniques:

    • X-ray crystallography

    • NMR spectroscopy

    • Cryo-electron microscopy

What experimental controls should be included when studying FV3-010R in vitro and in vivo?

Control TypeIn Vitro StudiesIn Vivo Studies
Negative Controls- Untransfected/uninfected cells
- Expression vector without insert
- Irrelevant protein of similar size
- Uninfected animals
- Animals infected with control virus
- Vehicle-only administration
Positive Controls- Known FV3 protein with established function
- Known interaction partner (if identified)
- Wild-type FV3 infection
- Established disease model
Procedural Controls- His-tag only protein
- Denatured FV3-010R
- Site-directed mutants
- Varying viral doses
- Time-course sampling
- Multiple tissue analysis

What computational methods are most appropriate for predicting the structure and function of FV3-010R?

For optimal structural and functional prediction:

  • Homology modeling:

    • SWISS-MODEL is effective for building homology models of uncharacterized proteins

    • D-I-TASSER can provide additional model refinement and functional inference

    • Compare multiple templates to ensure model robustness

  • Domain and motif identification:

    • Search for conserved domains using Pfam and CDD

    • Identify functional motifs using PROSITE and ELM

    • Look for structural signatures using CATH and SCOP databases

  • Molecular dynamics simulations:

    • Perform energy minimization using YASARA software

    • Run molecular dynamics simulations to assess stability and potential conformational changes

    • Use virtual docking to identify potential binding partners or ligands

  • Quality assessment:

    • Validate models using PROCHECK for Ramachandran plots

    • Employ VERIFY3D and ERRAT for additional validation

    • Calculate Z-scores using ProSA server

How can researchers determine the subcellular localization of FV3-010R during infection?

To determine subcellular localization:

  • Computational prediction:

    • Use multiple prediction tools (CELLO, PSORTb, SOSUIGramN, PSLpred, CCTOP)

    • Compare predictions to increase confidence (majority voting approach)

  • Fluorescence microscopy:

    • Generate GFP or other fluorescent protein fusions

    • Perform live-cell imaging during infection

    • Co-stain with markers for different cellular compartments

  • Subcellular fractionation:

    • Isolate nuclear, cytoplasmic, membrane, and organelle fractions

    • Detect FV3-010R using Western blotting

    • Quantify relative distribution across fractions

  • Immunogold electron microscopy:

    • Generate specific antibodies against FV3-010R

    • Localize at ultrastructural level in infected cells

    • Correlate with stages of viral assembly

  • Time-course studies:

    • Monitor localization changes during viral replication cycle

    • Correlate with other viral and cellular events

What techniques can identify potential binding partners or substrates of FV3-010R?

To identify interaction partners:

  • Affinity purification-mass spectrometry (AP-MS):

    • Use His-tagged FV3-010R as bait

    • Pull down interacting proteins from infected cell lysates

    • Identify using LC-MS/MS

  • Crosslinking MS approaches:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and identify crosslinked peptides by MS

    • Map interaction interfaces

  • Protein arrays:

    • Screen against arrays of host proteins, particularly from susceptible amphibian species

    • Test binding to nucleic acids using EMSA or filter-binding assays

  • Functional screening:

    • Yeast two-hybrid or split-reporter assays

    • Bimolecular fluorescence complementation (BiFC)

    • FRET/BRET approaches

  • In silico docking:

    • Perform virtual screening of potential ligands

    • Assess binding affinities using computational approaches

    • Validate top candidates experimentally

How might FV3-010R contribute to viral recombination patterns observed between FV3 and CMTV?

The role of FV3-010R in recombination patterns can be investigated through:

  • Genomic analysis:

    • Compare sequences of FV3-010R across different FV3 isolates to identify potential recombination breakpoints

    • Determine if FV3-010R contains mosaic sequences from multiple viral lineages

    • Assess if FV3-010R lies within known recombination hotspots in the FV3 genome

  • Experimental evolution:

    • Co-infect cells with FV3 and CMTV to generate recombinants

    • Sequence the 010R region in resulting recombinants

    • Analyze frequency of recombination events involving this locus

  • Structural implications:

    • Compare predicted structures of FV3-010R and CMTV homologs

    • Assess if recombination would disrupt protein function

    • Model hybrid proteins resulting from potential recombination events

What role might FV3-010R play in viral pathogenesis in amphibian hosts?

To investigate the role in pathogenesis:

  • Infection studies with modified viruses:

    • Generate FV3 variants with 010R deletions or mutations

    • Compare virulence in susceptible amphibian species

    • Analyze tissue tropism and viral loads

  • Host response analysis:

    • Compare immune responses to wild-type vs. 010R-modified FV3

    • Perform transcriptomics and proteomics on infected tissues

    • Investigate potential immunomodulatory functions

  • Cross-species comparison:

    • Test the impact of FV3-010R variants on different amphibian species

    • Correlate with species-specific susceptibility patterns

    • Examine potential host adaptation signatures

  • Recombinant functional analysis:

    • Express FV3-010R in amphibian cell lines

    • Assess impact on cell viability, morphology, and gene expression

    • Investigate potential cytopathic effects

Research has shown that recombination between FV3 and CMTV can lead to increased virulence . Some recombinant ORFs between these viruses are associated with important viral activities, including virion assembly, DNA metabolism, and host cell modulation .

How do recombination events between FV3 and CMTV affect the structure and function of viral proteins?

The impact of recombination on viral proteins can be studied through:

  • Comparative structural analysis:

    • Model structures of original and recombinant proteins

    • Identify structural disruptions or enhancements

    • Predict functional consequences of hybrid protein domains

  • Functional comparison:

    • Express and purify recombinant proteins from different viral strains

    • Compare biochemical activities and interaction profiles

    • Assess impacts on viral replication efficiency

  • Evolutionary analysis:

    • Calculate selection pressures on recombinant regions

    • Identify conserved vs. variable regions within mosaic proteins

    • Determine if recombination events are random or targeted

Studies have found that some ORFs from FV3 genomes contain mosaic sequences derived from both FV3 and CMTV lineages . Specifically, researchers identified eleven ORFs with mosaic patterns, including six core genes common to most Iridovirus species that play important roles in viral activities . These mosaic proteins may contribute to selective advantages for the viruses that acquire them.

What experimental designs are most appropriate for studying the temporal and spatial distribution of FV3 lineages containing specific variants of 010R?

To study the distribution patterns:

  • Sampling strategy:

    ParameterApproach
    Spatial coverageHierarchical sampling across geographical regions
    Temporal resolutionSeasonal sampling over multiple years
    Host diversityMultiple amphibian species from same locations
    Environmental factorsWater, sediment, and habitat sampling
    Control samplesReference locations with no reported FV3 outbreaks
  • Molecular detection and characterization:

    • Design primers specific to FV3-010R variants

    • Develop multiplex qPCR for variant detection

    • Perform selective whole-genome sequencing

    • Implement environmental DNA (eDNA) approaches

  • Data analysis framework:

    • Phylogenetic analysis incorporating temporal and spatial data

    • Statistical modeling of distribution patterns

    • Correlation with amphibian population dynamics and die-offs

    • Integration with international surveillance data

Research on Canadian FV3 isolates suggests that spatial and temporal phylogenetic analysis can provide insights into the recent origin (<100 years) and spread of FV3 lineages, potentially linked to international amphibian trade .

How can within-subject experimental designs enhance research on FV3-010R function in amphibian models?

Within-subject designs for FV3-010R research:

  • Advantages of within-subject approaches:

    • Increased statistical power with fewer animals

    • Control for individual variation in susceptibility

    • Allows time-course studies within the same organisms

  • Implementation strategies:

    • Contralateral limb comparisons (e.g., injection of wild-type vs. modified FV3)

    • Sequential infection with different viral strains following recovery

    • Monitoring multiple tissues from the same animal over time

  • Statistical considerations:

    • Account for non-independence of observations

    • Apply blocking designs with subjects as blocks

    • Utilize repeated measures ANOVA or mixed-effects models

  • Experimental table design example:

    Subject IDTime Point 1Time Point 2Time Point 3Time Point 4
    Amphibian 1Tissue Sample ATissue Sample BTissue Sample CFinal Analysis
    Amphibian 2Tissue Sample ATissue Sample BTissue Sample CFinal Analysis
    Amphibian 3Tissue Sample ATissue Sample BTissue Sample CFinal Analysis
  • Control implementation:

    • Use of within-animal controls when possible

    • Careful consideration of potential carryover effects

    • Randomization of treatment order where applicable

Within-subject designs create blocks of experimental units with reduced variance, allowing more precise detection of treatment effects . For FV3-010R studies, this approach can help identify subtle functional impacts while reducing the number of experimental animals required.

How should researchers integrate structural predictions, functional assays, and evolutionary analysis to fully characterize FV3-010R?

An integrated research approach should:

  • Begin with computational analysis:

    • Predict structure using multiple methodologies

    • Identify potential functional domains and motifs

    • Generate hypotheses about biochemical activities

  • Proceed to experimental validation:

    • Test predicted structures using biophysical methods

    • Assess hypothesized functions with in vitro assays

    • Validate cellular roles using infection models

  • Incorporate evolutionary context:

    • Compare sequences across ranavirus isolates

    • Identify conserved regions under purifying selection

    • Detect signatures of positive selection or recombination

  • Iterative refinement process:

    • Use experimental results to refine computational models

    • Generate new hypotheses based on validated findings

    • Develop increasingly specific functional assays

  • Integration framework example:

    Research PhaseTools/ApproachesExpected Outcomes
    Structure PredictionSwiss-Model, D-I-TASSER 3D model with confidence scores
    Functional Domain AnalysisConserved domain search, Motif analysisPredicted biochemical activities
    Experimental ValidationExpression, purification, activity assaysConfirmed function and mechanism
    Evolutionary AnalysisPhylogenetics, selection analysisEvolutionary constraints and importance
    Integrative ModelingCombined data synthesisComprehensive functional model

This integrated approach allows researchers to leverage the strengths of multiple methodologies while compensating for the limitations of individual techniques.

What are the implications of FV3-010R research for understanding amphibian disease ecology and conservation?

The broader implications include:

  • Disease surveillance applications:

    • Development of molecular markers targeting FV3-010R variants

    • Monitoring of recombination patterns in wild populations

    • Early detection of emerging virulent strains

  • Conservation strategy development:

    • Identification of particularly susceptible amphibian species

    • Implementation of targeted biosecurity measures

    • Design of potential intervention strategies

  • Understanding disease dynamics:

    • Correlation between FV3-010R variants and outbreak severity

    • Assessment of transmission patterns across populations

    • Modeling of virus-host coevolution

  • Broader ecological insights:

    • Impact of international amphibian trade on virus spread

    • Role of climate change in altering host-pathogen dynamics

    • Contribution to multiple stressor models of amphibian decline

Research has shown that FV3 is linked to amphibian die-offs across North America, and recombination events between FV3 and CMTV may generate variants with increased pathogenicity . Understanding the role of individual proteins like FV3-010R in these processes could provide critical insights for conservation efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.