Recombinant Frog virus 3 Uncharacterized protein 034R (FV3-034R)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Biophysical Properties

Recombinant FV3-034R is commercially available in diverse formats, optimized for research applications:

Product SpecificationDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE validated)
TagsHis-tag (N-terminal)
LengthFull-length (1–106 aa) or partial fragments
ApplicationsStructural studies, host-pathogen interaction assays, antibody development

Key Observations:

  • Expression Efficiency: Cell-free systems or E. coli yield higher purity (≥85%), while mammalian systems may offer native post-translational modifications .

  • Stability: Recombinant proteins require careful handling to prevent aggregation, typical for viral proteins expressed in heterologous systems .

Functional Hypotheses and Research Gaps

Despite its classification as an "uncharacterized" protein, FV3-034R’s genomic context suggests potential roles:

Putative Roles in Viral Replication

  • RNA Capping: Some iridoviral L-proteins mediate mRNA capping, a critical step for viral mRNA stability and translation . FV3-034R’s "L-protein-like" designation hints at analogous functions .

  • DNA Methylation: FV3 encodes a DNA methyltransferase to hypermethylate its genome, though FV3-034R’s role in this process is unexplored .

Host Interaction Mechanisms

  • Immune Evasion: Ranaviruses employ epigenetic regulation to suppress host interferon (IFN) responses . FV3-034R may modulate host transcriptional machinery or chromatin remodeling.

  • Viral Replication Stages: Early transcriptomic studies classified FV3 genes into immediate early (IE), delayed early (DE), and late (L) groups . FV3-034R’s temporal expression remains undefined.

Critical Gaps:

  • No direct functional assays (e.g., knockout studies) have been reported.

  • Structural data (e.g., X-ray crystallography) are absent, limiting mechanistic insights .

Relevance to Amphibian Disease Dynamics

FV3’s association with amphibian declines underscores the urgency of understanding its protein repertoire:

  • Recombination and Virulence: FV3-CMTV recombinants exhibit enhanced pathogenicity, though FV3-034R’s contribution to this phenotype is unknown .

  • Evolutionary Pressures: The protein’s uniqueness may reflect adaptive evolution for host-specific interactions, particularly in adult frogs that act as asymptomatic carriers .

Future Research Directions

  1. Functional Characterization:

    • Knockout Mutagenesis: Assess viral replication in FV3-034R-deficient strains.

    • Co-IP/MS: Identify interacting host/viral proteins to infer pathways.

  2. Structural Biology: Solve the 3D structure to predict catalytic sites or binding motifs.

  3. Comparative Genomics: Align FV3-034R with orthologs in other ranaviruses to identify conserved motifs.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
FV3-034R; Uncharacterized protein 034R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Frog virus 3 (isolate Goorha) (FV-3)
Target Names
FV3-034R
Target Protein Sequence
MSAGHLRKRRYVKVGDIHDMGPILGGVHDVSSPPPNVHYQQQDDHNDPGCMIHYPGEGWF SSMSTVEKLMLGAVIVAAVVVGVRMFMSSGNSSATSSFSTAPYFMG
Uniprot No.

Target Background

Database Links

KEGG: vg:2947813

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the temporal expression class of FV3-034R during viral replication?

FV3 genes are expressed in a coordinated fashion leading to the sequential appearance of immediate early (IE), delayed early (DE), and late (L) viral transcripts. While the specific temporal class of FV3-034R is not explicitly stated in the available data, researchers can determine this by examining its expression profile during a productive replication cycle using microarray or RT-PCR analysis.

Based on the transcriptome analysis of FV3, viral genes are classified into temporal classes by monitoring their expression at 2, 4, and 9 hours post-infection (HPI), as well as under conditions that restrict expression to specific classes (such as cycloheximide treatment or temperature-sensitive mutants) . A methodological approach would involve comparing FV3-034R expression patterns to known IE, DE, and L genes to classify it appropriately.

How is FV3-034R characterized structurally, and what domains does it contain?

Structural characterization of an uncharacterized protein like FV3-034R typically begins with bioinformatic approaches to predict domains and structural motifs. Researchers would use tools like BLAST, Pfam, SMART, or I-TASSER to identify potential domains by comparing the sequence with other known proteins.

For viral proteins in the Iridoviridae family, it's useful to look for conserved domains that might relate to:

  • Viral replication

  • Transcriptional regulation

  • Host immune evasion

  • Virion assembly

More detailed structural analysis would require techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine the three-dimensional structure of the protein.

Does FV3-034R have homologs in other ranaviruses or iridoviruses?

Identifying homologs requires comparative genomic analysis across multiple ranavirus and iridovirus genomes. Researchers would perform sequence alignment using tools like BLAST against other viral genomes in the Iridoviridae family.

The presence of recombination events between FV3 and common midwife toad virus (CMTV) identified in Canadian amphibian populations suggests that examining CMTV-like viruses for homologs is particularly important . Homology studies would also determine if FV3-034R is a core gene conserved across most iridoviruses or a unique accessory gene specific to FV3 or a subset of ranaviruses.

What experimental approaches can determine the function of FV3-034R?

To determine the function of an uncharacterized viral protein like FV3-034R, researchers should employ multiple complementary approaches:

  • Gene knockout/knockdown studies: Using CRISPR-Cas9 or antisense oligonucleotides to disrupt FV3-034R expression and observe resulting phenotypes.

  • Protein-protein interaction studies: Co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling techniques to identify binding partners.

  • Cellular localization studies: Fluorescent protein tagging to determine where FV3-034R localizes within infected cells.

  • Temporal expression analysis: RT-PCR, qRT-PCR, or microarray analysis to determine when during infection FV3-034R is expressed, which can provide clues to function .

If FV3-034R follows patterns observed with other FV3 genes, its temporal class might correlate with its function - regulatory factors, nucleic acid metabolism, and immune evasion proteins tend to be IE or DE genes, while those involved in DNA packaging and virion assembly are typically L genes .

How might the expression pattern of FV3-034R relate to its potential function?

The temporal expression of viral genes often correlates with their function in the viral replication cycle. Based on transcriptome analysis of FV3, we can establish some general patterns:

Temporal ClassTypical FunctionsExpression Characteristics
IE-S (Immediate Early-Stable)Regulatory factors, immune evasionExpressed within 2 HPI, message remains stable
IE-Tr (Immediate Early-Transient)Early regulatory functionsExpressed by 2 HPI, message declines by 9 HPI
DE (Delayed Early)Nucleic acid metabolismPeak expression around 4 HPI
L (Late)Structural proteins, DNA packagingHighest expression at 9 HPI

Understanding where FV3-034R fits in this pattern would provide insights into its potential function during the viral life cycle . For example, if it's expressed as an IE gene, it might be involved in transcriptional regulation or host immune evasion, while expression as a late gene would suggest potential involvement in virion assembly.

What role might FV3-034R play in viral pathogenesis and host specificity?

Understanding the role of FV3-034R in pathogenesis requires experimental approaches that examine:

  • Virulence studies: Comparing wild-type FV3 with FV3 lacking or mutated in the 034R gene to assess differences in pathogenicity in different amphibian hosts.

  • Host range experiments: Testing if deletion or modification of FV3-034R affects the virus's ability to replicate in different host species or cell types.

  • Host-protein interaction analysis: Identifying host proteins that interact with FV3-034R to understand potential immune evasion or host manipulation functions.

The recombination patterns observed between FV3 and CMTV suggest that hybrid ORFs can influence virulence . If FV3-034R is involved in a recombination event, this might affect pathogenicity, as recombinants between FV3 and CMTV have been shown to have higher pathogenicity .

Is FV3-034R involved in recombination events between FV3 and other ranaviruses?

To determine if FV3-034R is involved in recombination events, researchers would need to:

  • Conduct whole genome sequencing of multiple FV3 isolates from different geographical locations.

  • Perform recombination detection analysis using software like RDP4, SimPlot, or Bootscan to identify potential breakpoints within or surrounding the FV3-034R gene.

  • Compare sequences across various ranavirus species, particularly focusing on FV3 and CMTV lineages.

The research on Canadian FV3 isolates has revealed widespread recombination between FV3 and CMTV, with some ORFs showing mosaic structures . Eleven ORFs were identified with mosaic sequences between FV3 and CMTV, including some core genes common to most iridoviruses . Determining if FV3-034R is among these recombinant regions would provide insights into its evolutionary history and potential functional significance.

How does sequence variation in FV3-034R correlate with geographic distribution of FV3 isolates?

Understanding geographic variation requires:

  • Sequencing FV3-034R from multiple isolates across different regions.

  • Constructing phylogenetic trees to visualize relationships between different variants.

  • Correlating sequence variations with geographic and ecological factors.

The research on Canadian FV3 isolates suggests that FV3 in North America has a relatively recent origin (<100 years), potentially associated with international amphibian trade . Different recombination patterns in the viral population suggest multiple lineages circulating in wild northern Canadian amphibians . Examining if FV3-034R shows similar patterns of geographic variation would help understand its evolution and potential adaptation to different host populations.

What is the evolutionary conservation of FV3-034R across the Iridoviridae family?

To assess evolutionary conservation:

  • Conduct comparative genomic analysis across the Iridoviridae family.

  • Calculate selection pressure using dN/dS ratios to determine if FV3-034R is under purifying, neutral, or positive selection.

  • Identify conserved motifs or domains that might indicate functional importance.

Core genes common to most iridoviruses tend to be highly conserved due to their essential functions, while accessory genes may show more variation . Determining whether FV3-034R is a core gene or an accessory gene would provide insights into its evolutionary importance within the viral genome.

What are the best protocols for expressing and purifying recombinant FV3-034R for structural studies?

For effective expression and purification of recombinant FV3-034R:

  • Expression system selection:

    • Bacterial systems (E. coli): Simplest approach, but may lack proper folding for complex viral proteins

    • Yeast expression systems: Better for eukaryotic proteins with disulfide bonds

    • Baculovirus-insect cell systems: Often ideal for viral proteins that require eukaryotic post-translational modifications

    • Mammalian cell expression: Best for complex proteins requiring mammalian-specific modifications

  • Optimization of expression conditions:

    • Test multiple temperatures, induction times, and inducer concentrations

    • Consider codon optimization for the expression host

  • Purification strategy:

    • Affinity chromatography using His-tag, GST-tag, or other fusion tags

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography based on the protein's theoretical pI

  • Verification methods:

    • SDS-PAGE with Western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism to assess proper folding

How can researchers effectively detect FV3-034R expression during viral infection?

Detection methodologies include:

  • Transcript detection:

    • RT-PCR or qRT-PCR using primers specific to FV3-034R

    • Microarray analysis as described in the FV3 transcriptome study

    • RNA-Seq for comprehensive transcriptome analysis

  • Protein detection:

    • Generation of specific antibodies against recombinant FV3-034R

    • Western blotting to detect protein in infected cell lysates

    • Immunofluorescence microscopy to visualize cellular localization

  • Temporal monitoring:

    • Time course experiments sampling at 2, 4, and 9 hours post-infection as described in previous FV3 studies

    • Use of cycloheximide (CHX) to block protein synthesis and identify if FV3-034R is an immediate early gene

    • Use of temperature-sensitive mutants like ts5 to block late gene expression and determine temporal class

What cell culture systems are optimal for studying FV3-034R function?

The choice of cell culture system depends on research objectives:

  • Standard cell lines for FV3 research:

    • Fathead minnow (FHM) cells: Commonly used for FV3 studies

    • Baby hamster kidney (BHK) cells: Support FV3 replication

    • Xenopus laevis cell lines: More biologically relevant for amphibian virus

  • Primary cell cultures:

    • Primary amphibian kidney or liver cells: More representative of natural host cells

    • Immune cells from amphibian species: Important for studying immune evasion functions

  • Experimental considerations:

    • Temperature sensitivity: Amphibian cells typically grow at lower temperatures (18-25°C)

    • Cytopathic effects: Monitor for cell rounding, aggregation, and lysis

    • Permissivity vs. non-permissivity: Different cell types may support different levels of viral replication

How might FV3-034R interact with host immune responses in amphibians?

Understanding potential immune interactions requires:

  • Infection studies in different amphibian species:

    • Compare immune responses in susceptible vs. resistant amphibian species

    • Analyze differences between larval and adult amphibians, which show different susceptibility to FV3

  • Immune pathway analysis:

    • Examine effects on interferon responses, a key antiviral defense

    • Investigate interactions with pattern recognition receptors (PRRs)

    • Test effects on NF-κB signaling and inflammatory responses

  • Comparative analysis across species:

    • Compare immune evasion capabilities in different amphibian hosts

    • Investigate if recombination events involving FV3-034R affect immune evasion capabilities

If FV3-034R functions similarly to other viral proteins involved in immune evasion, it might target host immune signaling pathways, interfere with cytokine production, or inhibit antigen presentation. The fact that FV3 has been linked to amphibian population declines suggests its proteins effectively counter host immune responses .

What computational approaches can predict FV3-034R structure and function?

Modern computational approaches include:

  • Homology modeling and threading:

    • I-TASSER, SWISS-MODEL, or Phyre2 for structure prediction

    • AlphaFold2 for advanced protein structure prediction

    • Comparison with structural databases for functional insights

  • Molecular dynamics simulations:

    • GROMACS or AMBER for simulating protein behavior

    • Analysis of flexibility and potential binding sites

  • Function prediction tools:

    • Sequence-based function prediction using tools like InterProScan

    • Structure-based function prediction using ProFunc or COFACTOR

    • Binding site prediction using CASTp or LIGSITE

  • Network analysis:

    • Prediction of protein-protein interactions with STRING or STITCH

    • Integration with known viral-host interaction networks

How does the nucleotide composition and codon usage of FV3-034R compare to other FV3 genes and host genes?

Nucleotide composition and codon usage analyses provide insights into viral evolution and host adaptation:

Genes that are highly expressed in late stages of infection might show codon usage patterns optimized for the host translation machinery, while genes expressed earlier might be under different selective pressures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.