Recombinant Frog virus 3 Uncharacterized protein 043R (FV3-043R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
FV3-043R; Uncharacterized protein 043R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Frog virus 3 (isolate Goorha) (FV-3)
Target Names
FV3-043R
Target Protein Sequence
MEEVDGCAGPNSEAGALTAGALTAGAFAVTAGAGVAGAGVAGVGWCSWCSWCSWCWCSWC SWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCLSKGWEDRGGLEGCKSCKGWCL CSHCWCWCSWCWCSWCSWCLSKGWEDRGGLEGCKSCKGWCLCSHCRCWSIN
Uniprot No.

Target Background

Database Links

KEGG: vg:2947822

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Frog Virus 3 and how does it relate to amphibian decline?

Frog Virus 3 (FV3) is a widespread ranavirus that can infect both wild and captive amphibians. It has been linked to significant population declines across North America. As a member of the Iridoviridae family, FV3 contains a double-stranded DNA genome that undergoes frequent recombination events. Studies indicate that FV3 has caused massive die-offs across continents and represents one of several pathogens contributing to worldwide amphibian population declines alongside anthropogenic factors . Phylogenetic analyses suggest a relatively recent origin for FV3 lineages in Canada (within the last 100 years), potentially associated with the international amphibian trade .

What is known about uncharacterized proteins in FV3?

FV3 contains multiple open reading frames (ORFs) encoding proteins with unknown functions, including 043R. While specific information about 043R remains limited, research on FV3 genomes has revealed that uncharacterized proteins often play crucial roles in viral replication, host immune evasion, or pathogenicity. Many uncharacterized proteins in FV3 show varying degrees of conservation across ranavirus isolates, suggesting functional importance. Recent genome sequencing projects have identified several previously uncharacterized proteins that participate in recombination events between FV3 and related viruses like Common Midwife Toad Virus (CMTV) .

How is recombination observed in FV3 genomes?

Recombination in FV3 has been extensively documented through whole genome sequencing. In a study of 18 FV3 isolates from Canadian amphibians, researchers identified varying patterns of recombination with CMTV-like viruses. Some isolates showed no recombination, while others displayed one to two recombination events. Most recombination breakpoints occurred within open reading frames, generating novel mosaic ORFs and proteins that combined elements from both FV3 and CMTV . The presence of different recombination patterns indicates that viruses with varied genomic compositions are circulating in wild amphibian populations.

What methodologies are recommended for characterizing previously uncharacterized proteins like FV3-043R?

Characterizing uncharacterized viral proteins requires a multifaceted approach:

  • Bioinformatic analysis: Begin with sequence homology searches, protein domain prediction, and structure modeling. For FV3-043R, compare sequences across ranavirus isolates to identify conserved regions that might indicate functional domains.

  • Recombinant protein expression: Express the protein in prokaryotic (E. coli) or eukaryotic systems (insect cells) with appropriate tags for purification and detection.

  • Functional assays: Design experiments based on predicted functions – if 043R appears structurally similar to proteins involved in DNA replication, test for DNA-binding activity and effects on replication rates.

  • Protein-protein interaction studies: Use co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling to identify viral or host proteins that interact with 043R.

  • Knockout/knockdown studies: Generate FV3 mutants lacking 043R to assess changes in viral fitness, host range, or pathogenicity.

  • Structural biology: Determine the three-dimensional structure through X-ray crystallography or cryo-electron microscopy to gain insights into function.

When studying recombinant proteins from FV3, researchers should consider the high recombination rates observed in natural isolates, as these may affect protein function or expression .

How might recombination events affect the structure and function of FV3-043R?

Recombination events in FV3 frequently generate mosaic proteins with segments derived from different viral strains. Analysis of recombination breakpoints in 18 FV3 genomes revealed that several proteins contained portions from both FV3 and CMTV viruses . If 043R is involved in such recombination events, its structure and function could be significantly altered.

When recombination breakpoints occur within an ORF, they may:

  • Create chimeric proteins with novel functional properties

  • Disrupt functional domains, potentially inactivating the protein

  • Introduce new domains that confer additional functions

  • Alter protein stability or localization within infected cells

FV3/CMTV recombinant proteins have shown ratios of original to recombinant sequences ranging from 0 (entirely CMTV-like) to 0.98 (mostly FV3-like) . For proteins involved in virulence or host immune evasion, these recombination events could potentially enhance pathogenicity. Researchers studying 043R should therefore consider whether different variants exist across viral isolates and how these variations might impact protein function.

What evolutionary pressures might shape FV3-043R diversity across viral isolates?

The evolutionary trajectory of FV3 proteins is influenced by several factors:

  • Host immune pressure: Proteins targeted by host immune responses often show accelerated evolution to evade detection.

  • Host range adaptation: FV3 can infect multiple amphibian species, potentially driving adaptive changes in proteins involved in host attachment and entry.

  • Recombination with related viruses: As demonstrated in Canadian FV3 isolates, recombination with CMTV and other ranaviruses introduces genetic diversity .

  • Geographic isolation: Different viral populations may evolve independently, as seen in the divergence between Ontario and northern Canadian FV3 isolates .

What are the optimal conditions for expression and purification of recombinant FV3-043R?

When expressing recombinant FV3-043R, consider these key parameters:

Expression system selection:

  • Prokaryotic systems: E. coli BL21(DE3) provides high yield but may not support proper folding or post-translational modifications

  • Eukaryotic systems: Insect cells (Sf9, Hi5) using baculovirus vectors more closely mimic the natural environment for viral protein folding

Optimization protocol:

  • Generate constructs with different fusion tags (His, GST, MBP) to improve solubility

  • Test multiple induction conditions (temperature, inducer concentration, duration)

  • Evaluate solubility in various buffer compositions (pH range 6.5-8.5, salt concentrations 150-500mM)

  • Implement a purification strategy using affinity chromatography followed by size exclusion

Recommended starting conditions:

  • Expression in insect cells using a C-terminal His-tag

  • Growth at 27°C with harvest 72 hours post-infection

  • Lysis in 50mM Tris pH 8.0, 300mM NaCl, 10% glycerol, 1mM DTT with protease inhibitors

  • Purification using IMAC followed by gel filtration

For difficult-to-express viral proteins like potential 043R homologs, researchers have reported success with detergent screening (0.1% NP-40 or 0.05% DDM) and inclusion of chaperone co-expression systems.

What methods are effective for studying potential recombination events affecting FV3-043R?

To investigate recombination events affecting FV3-043R:

Genome sequencing and comparative analysis:

  • Complete genome sequencing: Use next-generation sequencing platforms (Illumina, Oxford Nanopore) to obtain full viral genomes from diverse isolates

  • Sequence alignment: Employ multiple sequence alignment tools (MAFFT, MUSCLE) to compare 043R sequences across isolates

  • Recombination detection: Apply specialized software including:

    • RDP4 suite (RDP, GENECONV, Bootscan, MaxChi, Chimaera, SiScan, 3Seq)

    • SimPlot for visualization of sequence similarity

    • GARD for identification of recombination breakpoints

Validation approaches:

  • PCR amplification and Sanger sequencing of suspected recombination junctions

  • Cloning and functional testing of recombinant variants

  • Phylogenetic analysis of sequences flanking potential breakpoints

In a study of 18 FV3 isolates, researchers identified several recombination patterns with breakpoints frequently occurring within ORFs . When analyzing potential recombination affecting 043R, researchers should examine both the gene itself and surrounding genomic regions, as recombination events often affect multiple adjacent genes.

How should researchers design functional assays to determine the role of FV3-043R in viral replication?

Design a comprehensive functional analysis strategy:

Knockout/knockdown approaches:

  • CRISPR-Cas9 editing: Target the 043R locus in infectious FV3 clones

  • Antisense morpholino oligonucleotides: Block 043R translation during infection

  • Dominant-negative mutants: Express truncated or mutated versions of 043R

Phenotypic assays for 043R-deficient viruses:

  • Growth curves in permissive cell lines (e.g., FHM, BF-2)

  • Plaque size and morphology assessment

  • Viral genome replication quantification via qPCR

  • Virion assembly evaluation through electron microscopy

  • Host range testing across multiple amphibian cell lines

Complementation studies:

  • Trans-complementation with wild-type 043R to restore function

  • Domain-specific complementation to identify functional regions

Localization studies:

  • Immunofluorescence microscopy to track 043R during infection

  • Subcellular fractionation followed by western blotting

  • Time-course analysis of expression and localization

When studying uncharacterized viral proteins involved in recombination events, it's crucial to examine multiple isolates, as different recombination patterns may affect protein function. The high nucleotide diversity observed in some FV3 genomic regions suggests that functional differences may exist between isolates from different geographic locations .

How does FV3 genomic diversity impact research on uncharacterized proteins like 043R?

The significant genomic diversity in FV3 isolates presents both challenges and opportunities for researchers studying uncharacterized proteins:

Nucleotide diversity across FV3 genomes:
Analysis of FV3 isolates from Canada revealed variable nucleotide diversity across the genome, with highest diversity in regions affected by recombination events . When examining nucleotide diversity data:

Genomic RegionNotable FeaturesNucleotide DiversityRecombination Association
ORF 32RNeurofilament triplet H1-like proteinHighNot associated
ORF 90RMajor capsid proteinHighNot associated
ORF 24R-25R regionBetween two ORFsVery high in KEN samplesAssociated with recombination
ORF 36LUnknown functionHighNot associated

For uncharacterized proteins like 043R, researchers should determine whether it falls within high-diversity regions, as this may indicate:

  • Functional plasticity allowing significant sequence variation

  • Involvement in host adaptation or immune evasion

  • Potential selective pressures driving evolution

Research implications:

  • Sample multiple isolates when characterizing uncharacterized proteins

  • Consider geographic origin when interpreting functional data

  • Assess whether observed phenotypes are isolate-specific or conserved

  • Evaluate potential functional differences between recombinant variants

What statistical approaches are recommended for analyzing evolutionary patterns in FV3-043R?

For robust evolutionary analysis of FV3-043R:

Sequence-based analyses:

  • Selection pressure analysis: Calculate dN/dS ratios using PAML, SLAC, or FEL methods to identify sites under positive or purifying selection

  • Ancestral sequence reconstruction: Infer evolutionary history using FastML or MEGA

  • Bayesian evolutionary analysis: Employ BEAST for time-calibrated phylogenies and substitution rate estimation

Temporal analysis:
Use calibrated molecular clock approaches to estimate divergence times, as applied to FV3 lineages in Canada :

CladeEstimated Years Before Present (median)95% HPD
CMTV-like745590-921
FV3-like342271-423
Americas FV3-like186147-230
Canadian ranavirus, FV3, SSME8974-105
Canadian ranavirus, FV37767-89
Canadian ranavirus (REC, FV3, WBRV)7159-86
CAN-FV33728-46

Recombination analysis:

  • Identify potential breakpoints using RDP4 suite

  • Evaluate the impact of recombination on selection inference

  • Construct separate phylogenies for regions with different evolutionary histories

The measured substitution rate for FV3 (1.65 × 10^-5 substitutions/site/year) provides a baseline for expected sequence evolution. Significant deviations from this rate in 043R might indicate unusual selective pressures or recombination events affecting this locus.

How should contradictory functional data for FV3-043R be reconciled in research publications?

When confronted with contradictory data regarding FV3-043R function:

Systematic evaluation protocol:

  • Assess methodological differences:

    • Cell lines and culture conditions

    • Protein expression systems and purification methods

    • Assay sensitivity and specificity

    • Viral isolates used (potential recombinants vs. non-recombinants)

  • Consider genomic context:

    • Determine if studies used different FV3 variants with distinct recombination patterns

    • Evaluate 043R sequence similarity between studies

    • Assess whether surrounding genomic regions differ between isolates

  • Validate with complementary approaches:

    • If one study shows a phenotype using knock-out and another doesn't, validate with knock-down or dominant-negative approaches

    • Confirm protein-protein interactions using multiple methods (Y2H, co-IP, proximity labeling)

    • Validate in vitro findings with in vivo models when possible

  • Integrate contextual factors:

    • Cell type-specific effects

    • Temperature-dependent phenotypes (relevant for cold-blooded host pathogens)

    • Temporal dynamics during infection cycle

The extensive recombination observed in FV3 isolates means that functional differences may reflect genuine biological variation rather than experimental artifacts. When reporting contradictory findings, researchers should clearly specify the viral isolate used, including any known recombination events, and discuss how genomic context might influence protein function.

What are the most promising approaches for determining the structure of FV3-043R?

For structural characterization of FV3-043R:

Experimental structure determination approaches:

  • X-ray crystallography pipeline:

    • Optimize protein constructs by removing flexible regions

    • Screen multiple buffer conditions using thermal shift assays

    • Implement high-throughput crystallization screens (vapor diffusion, batch methods)

    • Consider fusion partners (T4 lysozyme, BRIL) to facilitate crystallization

  • Cryo-electron microscopy approach:

    • For challenging proteins resistant to crystallization

    • Particularly useful if 043R forms larger complexes with other viral proteins

    • May require GraFix or other stabilization methods

  • NMR spectroscopy:

    • Suitable for smaller domains (<25 kDa)

    • Allows study of dynamics and weak interactions

    • Requires isotopic labeling (13C, 15N) in specialized expression systems

Computational structure prediction:

  • AlphaFold2/RoseTTAFold: These AI-based methods have revolutionized protein structure prediction and work well for viral proteins

  • Molecular dynamics simulations: Refine predicted structures and study conformational flexibility

  • Integrative modeling: Combine low-resolution experimental data (SAXS, crosslinking) with computational predictions

The optimal approach depends on protein size, stability, and expression levels. For FV3 proteins involved in recombination events, researchers should consider analyzing multiple variants to understand structural impacts of sequence diversity.

How might high-throughput proteomics contribute to understanding FV3-043R function?

High-throughput proteomics offers powerful approaches to decipher 043R function:

Interaction proteomics strategies:

  • Proximity-dependent biotin labeling (BioID, TurboID):

    • Express 043R fused to a biotin ligase in host cells

    • Identify proteins in close proximity during infection

    • Compare interactomes across different cell types and time points

  • Affinity purification-mass spectrometry (AP-MS):

    • Immunoprecipitate tagged 043R with associated protein complexes

    • Identify interaction partners through LC-MS/MS

    • Implement SILAC or TMT labeling for quantitative analysis

  • Thermal proteome profiling (TPP):

    • Detect proteins whose thermal stability changes upon binding to 043R

    • Particularly useful for identifying unexpected interactions

Global proteome impact assessment:

  • Quantitative proteomics comparing wild-type and 043R-deficient virus:

    • Identify proteins with altered abundance or post-translational modifications

    • Reveal pathways disrupted by 043R deletion

  • Phosphoproteomics and ubiquitylomics:

    • Determine if 043R affects post-translational modification landscapes

    • Map signaling pathways perturbed during infection

When analyzing proteomics data from different FV3 isolates, researchers should consider the impact of recombination events on protein function. Distinct interaction networks may emerge from variants with different recombination patterns, providing insights into functional divergence across isolates .

What considerations should guide research on the role of FV3-043R in viral pathogenesis?

When investigating 043R's potential role in pathogenesis:

Experimental model considerations:

  • In vitro systems:

    • Compare infection outcomes in amphibian cell lines from different species

    • Develop organoid models that better reflect tissue architecture

    • Implement primary cell cultures from susceptible amphibian species

  • In vivo approaches:

    • Use ethical considerations to guide animal model selection

    • Consider both laboratory models (Xenopus) and naturally affected species

    • Implement infection studies with wild-type and 043R-modified viruses

Pathogenesis-related indicators to monitor:

  • Viral replication kinetics and tissue tropism

  • Host immune response profiles (cytokine expression, immune cell recruitment)

  • Apoptosis and tissue damage markers

  • Viral shedding and transmission dynamics

Comparative genomic approach:
Analyze 043R sequence and presence across isolates with different virulence profiles. The observed recombination patterns in FV3 isolates from Canada suggest that genomic composition influences pathogenicity, with some ORFs involved in virulence being subject to recombination events. Researchers should determine whether 043R:

  • Shows sequence conservation across isolates (suggesting essential function)

  • Varies between high and low virulence isolates

  • Bears similarity to virulence factors in related viruses

  • Is involved in recombination events that correlate with pathogenicity

How does research on FV3-043R contribute to broader understanding of ranavirus evolution?

Research on uncharacterized proteins like FV3-043R provides critical insights into ranavirus biology:

  • Evolutionary dynamics: Characterizing the function and structure of 043R adds to our understanding of protein evolution within the Iridoviridae family, particularly in the context of the recombination events observed between FV3 and CMTV .

  • Core vs. accessory genome components: Determining whether 043R is part of the core genome (conserved across ranaviruses) or accessory genome (variable) helps define essential viral functions.

  • Host adaptation mechanisms: If 043R shows host-specific functions, it may represent a component involved in host range determination or species-specific virulence.

  • Recombination impacts: The extensive recombination observed in FV3 genomes highlights the importance of studying how these events affect protein function and viral fitness.

The emergence of recombinant ranaviruses with potentially enhanced virulence underscores the need to characterize all viral proteins, including those currently uncharacterized like 043R, to better understand pathogenesis mechanisms and develop potential intervention strategies.

What are the implications of FV3 research for amphibian conservation efforts?

Research on FV3 proteins has significant conservation implications:

  • Improved diagnostics: Understanding the genetic diversity of FV3, including recombinant variants, enables development of more sensitive and specific diagnostic tools for wildlife surveillance.

  • Risk assessment: The relatively recent emergence of FV3 in Canada (<100 years) and its association with international amphibian trade highlights the ongoing risk of pathogen introduction to naive populations.

  • Management strategies: Characterizing virulence factors may guide development of management approaches for captive breeding programs and reintroduction efforts.

  • Policy implications: Evidence linking amphibian trade to viral spread provides scientific basis for biosecurity protocols and trade regulations to protect vulnerable species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.