Recombinant Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic (FCPA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
FCPA; FCP1; Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-196
Protein Length
Full Length of Mature Protein
Species
Phaeodactylum tricornutum (Diatom)
Target Names
FCPA
Target Protein Sequence
AFENEIGAQQPLGYWDPLGLVADGNQEKFDRLRYVEIKHGRICMLAVAGYLTQEAGIRLP GDIDYSGTSFESIPNGFAALSAVPGAGIAQIIAFIGFFEIAVMKDITGGEFVGDFRNNYL DFGWDTFSEDKKLQKRAIELNQGRAAQMGILALMVHEQLGVSILP
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and delivering excitation energy to associated photosystems. Energy transfer occurs from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, facilitating ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is the functional role of Fucoxanthin-Chlorophyll a-c Binding Protein A in photosynthetic organisms?

Fucoxanthin-Chlorophyll a-c Binding Protein A functions as a primary light-harvesting complex in diatoms and other fucoxanthin-containing organisms. Unlike terrestrial plants that primarily utilize chlorophylls for light absorption, these marine organisms employ fucoxanthin as their main light-harvesting pigment. The protein binds both fucoxanthin and chlorophyll molecules, creating a specialized antenna complex that absorbs green light efficiently, complementing the absorption spectra of chlorophylls. This adaptation allows these organisms to photosynthesize effectively in aquatic environments where red and blue light penetration is limited. When FCPA genes are disrupted, the organisms typically exhibit altered coloration (appearing green rather than brown) and demonstrate reduced light-harvesting capability and growth .

How does the structure of FCPA differ from light-harvesting complexes in terrestrial plants?

FCPA possesses a distinct protein structure optimized for binding fucoxanthin molecules alongside chlorophyll a and c, unlike the light-harvesting complexes in land plants that primarily bind chlorophyll a and b. The protein contains specific binding domains that accommodate the unique structural features of fucoxanthin, including its characteristic keto group and carbon chain configuration. This structural arrangement creates an efficient energy transfer pathway from fucoxanthin to chlorophyll a, enabling effective harvesting of green wavelengths that penetrate deeper in aquatic environments. The spatial organization of pigments within FCPA facilitates directional energy transfer toward photosystem reaction centers with minimal energy loss, representing an evolutionary adaptation to marine light conditions .

What expression systems are commonly used for producing recombinant FCPA?

The most widely used expression system for recombinant FCPA production is Escherichia coli, which provides several advantages including rapid growth, high protein yields, and established transformation protocols. When expressing full-length mature FCPA (typically amino acids 32-197 in Phaeodactylum tricornutum), researchers commonly incorporate His-tags to facilitate purification through affinity chromatography. The recombinant protein is typically expressed as a fusion construct with appropriate signal sequences removed to ensure proper folding and stability. Following expression, the protein is often provided in lyophilized powder form to maintain stability during storage and transportation . Alternative expression systems such as yeast or insect cells may be utilized when post-translational modifications are required for functional studies.

How do mutations in specific binding domains of FCPA affect its interaction with fucoxanthin and energy transfer efficiency?

Targeted mutations in the fucoxanthin-binding domains of FCPA significantly alter both binding affinity and energy transfer kinetics. Research using site-directed mutagenesis has revealed that specific amino acid residues within the hydrophobic binding pockets are critical for stabilizing fucoxanthin molecules in the optimal orientation for efficient excitation energy transfer. When conserved aromatic residues (typically tryptophan and phenylalanine) that form π-stacking interactions with fucoxanthin are substituted, researchers observe decreased binding affinity and dramatically reduced energy transfer efficiency between fucoxanthin and chlorophyll a. These effects can be quantified through fluorescence spectroscopy, revealing longer excited-state lifetimes and lower quantum yields of energy transfer. Circular dichroism spectroscopy further demonstrates that such mutations may induce subtle conformational changes that propagate through the protein structure, affecting distant binding sites through allosteric mechanisms .

What methodological approaches can resolve contradictory data regarding FCPA assembly into higher-order light-harvesting complexes?

Contradictory findings regarding FCPA oligomerization and supramolecular assembly can be resolved through a multi-technique approach that combines:

  • Native mass spectrometry with gentle ionization conditions to preserve non-covalent interactions

  • Analytical ultracentrifugation to determine stoichiometry in solution under physiological conditions

  • Förster resonance energy transfer (FRET) measurements between labeled FCPA units to establish proximity relationships

  • Cryo-electron microscopy to visualize higher-order structures directly

Researchers should systematically vary experimental conditions, particularly detergent concentrations and lipid compositions, as these factors significantly influence oligomerization state. Comparative studies between recombinant and native FCPA complexes isolated directly from organisms can highlight potential artifacts introduced during recombinant expression. Cross-linking experiments with MS/MS analysis can further verify spatial relationships between subunits, providing distance constraints for structural modeling .

How does phosphorylation status affect FCPA function in response to changing light conditions?

FCPA contains multiple conserved phosphorylation sites that serve as regulatory switches for photoacclimation processes. Phosphoproteomic studies have identified at least four serine/threonine residues that undergo differential phosphorylation depending on light intensity and spectral quality. When exposed to high light conditions, increased phosphorylation of specific residues triggers conformational changes that modify excitation energy distribution between photosystems. This phosphorylation-dependent regulation optimizes light harvesting while minimizing photooxidative damage.

Experimental approaches to study this phenomenon include:

TechniqueApplicationMeasurable Outcome
Phosphoproteomic MSIdentification of phosphorylation sitesExact positions and stoichiometry of phosphorylated residues
Site-directed mutagenesisCreation of phosphomimetic variantsFunctional consequence of permanent phosphorylation
In vitro kinase assaysIdentification of responsible kinasesSpecificity and kinetics of phosphorylation reactions
Time-resolved fluorescenceMeasure energy transfer dynamicsChanges in excitation energy distribution
Thylakoid membrane reconstitutionStudy behavior in native-like environmentInteraction with photosystems under controlled conditions

These approaches collectively reveal how reversible phosphorylation provides a rapid mechanism for adjusting light-harvesting efficiency in response to fluctuating environmental conditions .

What are the optimal conditions for expressing and purifying recombinant FCPA with proper folding and pigment binding capabilities?

Successful expression of functional recombinant FCPA requires careful optimization to ensure proper protein folding and pigment binding. The following protocol has demonstrated high yield and activity:

  • Expression vector selection: pET-28a(+) with an N-terminal His-tag and thrombin cleavage site

  • Host strain: E. coli BL21(DE3) supplemented with rare codons (pRARE plasmid)

  • Culture conditions: Growth at 30°C until OD600 reaches 0.6-0.8, followed by temperature reduction to 18°C before induction

  • Induction: 0.4 mM IPTG for 16-18 hours

  • Lysis: Sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF

  • Purification: Two-step process using Ni-NTA affinity chromatography followed by size exclusion chromatography

  • Reconstitution with pigments: Incubation with 5-fold molar excess of isolated fucoxanthin and chlorophyll in the presence of phospholipids (DOPC:MGDG, 7:3)

  • Removal of unbound pigments: Sucrose gradient ultracentrifugation

This approach typically yields 4-5 mg of reconstituted FCPA per liter of bacterial culture with approximately 80% spectroscopic properties matching the native protein. Circular dichroism and absorption spectroscopy confirm proper pigment binding and protein folding .

What techniques can effectively assess the functional integrity of recombinant FCPA in vitro?

Evaluating the functional integrity of recombinant FCPA requires a comprehensive suite of biophysical techniques that probe both structural organization and energy transfer capabilities:

  • Absorption spectroscopy (400-700 nm) to verify characteristic peaks of bound fucoxanthin (490-550 nm) and chlorophyll a (436 and 663 nm)

  • Fluorescence excitation spectra with emission monitored at 680 nm to quantify energy transfer efficiency from fucoxanthin to chlorophyll a

  • Time-resolved fluorescence measurements to determine excited-state lifetimes and energy transfer kinetics

  • Circular dichroism in far-UV (190-250 nm) and visible regions (400-700 nm) to assess protein secondary structure and pigment-protein interactions

  • Thermal stability assays monitoring CD signal changes to determine melting temperature and stability

  • Pigment extraction and HPLC analysis to quantify pigment stoichiometry

  • Native PAGE combined with in-gel fluorescence to verify oligomeric state

Functional recombinant FCPA should exhibit:

  • Characteristic absorption peaks matching native complexes

  • Energy transfer efficiency from fucoxanthin to chlorophyll a exceeding 80%

  • Excited-state decay kinetics with dominant lifetime components of 400-600 ps

  • Thermal stability with melting temperatures above 60°C

  • Pigment:protein ratios matching native complexes

How can researchers distinguish between direct FCPA-dependent effects and indirect metabolic changes in gene knockout studies?

When analyzing FCPA knockout or knockdown phenotypes, researchers must implement controls that differentiate direct photosynthetic effects from secondary metabolic adaptations. A comprehensive experimental design should include:

  • Generation of complementation lines expressing wild-type FCPA to verify phenotype rescue

  • Creation of point mutants affecting specific functions (e.g., fucoxanthin binding but not protein stability)

  • Time-course analysis following inducible gene silencing to separate immediate from adaptive responses

  • Metabolomic profiling at multiple time points to track metabolic adjustments

  • Parallel analysis of photosynthetic parameters and growth in different light regimes

Comparative transcriptome analysis between acute (24-48 hours) and chronic (7+ days) FCPA deficiency can reveal compensatory mechanisms and indirect effects. Researchers should implement statistical methods such as path analysis or structural equation modeling to distinguish direct from indirect relationships in their datasets. Additionally, dynamic modeling incorporating rate constants for photosynthetic processes can help predict expected outcomes from direct FCPA perturbation versus secondary metabolic adaptations .

What structural analysis techniques provide the most detailed information about FCPA-pigment interactions?

Multiple complementary structural biology techniques can be integrated to elucidate FCPA-pigment interactions at different resolution levels:

TechniqueResolutionInformation ObtainedLimitations
X-ray crystallography1.5-3.0 ÅPrecise atomic coordinates of protein and pigmentsChallenging crystallization, static structure
Cryo-electron microscopy2.5-4.0 ÅNative-like conditions, conformational statesLower resolution for smaller proteins
Solid-state NMRSite-specificLocal environment of specific residues, dynamicsRequires isotopic labeling, complex interpretation
Hydrogen-deuterium exchange MSPeptide regionsSolvent accessibility, conformational changesIndirect structural information
Molecular dynamics simulationsAtomicDynamic interactions, energy landscapesRequires validation with experimental data

How can researchers accurately quantify energy transfer efficiency in FCPA complexes under varying experimental conditions?

Accurate quantification of energy transfer efficiency in FCPA requires combining steady-state and time-resolved spectroscopic techniques with careful data analysis. The following methodological approach minimizes artifacts and ensures reproducibility:

  • Steady-state measurements:

    • Fluorescence excitation spectra normalized to absorption

    • Correction for inner filter effects using appropriate dilutions

    • Quantum yield determination using an integrating sphere

  • Time-resolved measurements:

    • Ultrafast transient absorption spectroscopy (10 fs to 1 ns)

    • Time-correlated single photon counting (100 ps to 10 ns)

    • Global analysis using compartmental models

  • Data analysis:

    • Target analysis to extract species-associated spectra

    • Rate constants for energy transfer between specific pigments

    • Calculation of transfer efficiency from rate constants

To separate experimental variables, researchers should systematically vary:

  • Temperature (10-30°C) to modulate dynamic processes

  • pH (6.0-8.0) to alter protein conformation

  • Ionic strength to affect electrostatic interactions

  • Detergent concentration to mimic different membrane environments

Statistical rigor requires biological triplicates and technical replicates with propagation of uncertainty through all calculations. When comparing different FCPA variants or experimental conditions, researchers should conduct ANOVA with appropriate post-hoc tests and report effect sizes alongside p-values .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.