Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FCPD; Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-197
Protein Length
Full Length of Mature Protein
Species
Phaeodactylum tricornutum (Diatom)
Target Names
FCPD
Target Protein Sequence
AFEDELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVVGYLVQEAGVRLP GTIDYSGKTFAEIPSLAAFKEIPAGGLVQLLFFIGVLESSVMRDLTGEAEFVGDFRNGAI DFGWDTFDEETQFKKRAIELNQGRAAQMGILALMVHEQLGVSLLPQ
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy is transferred from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, enabling ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is the basic function of FCPD in photosynthetic organisms?

FCPD is a specialized light-harvesting protein that binds fucoxanthin and chlorophyll a/c pigments in the photosynthetic apparatus of diatoms, haptophytes, and brown algae. It serves primarily to capture green light that other photosynthetic organisms cannot utilize effectively. The carbonyl group within fucoxanthin's conjugated double-bond system produces a red-shifted absorbance, enabling efficient absorption of green wavelengths . This adaptation allows these organisms to occupy ecological niches where green light predominates, such as coastal and turbid waters. Unlike chlorophyll a/b binding proteins found in green algae and land plants, FCPs are optimized for marine environments where light quality differs substantially from terrestrial conditions .

How does the molecular structure of FCPD compare to other light-harvesting complex proteins?

FCPD belongs to the superfamily of chlorophyll-binding proteins that are phylogenetically related to light-harvesting complexes (LHCs) found in land plants, despite binding different carotenoids . The protein structure contains multiple membrane-spanning helices that coordinate chlorophyll and fucoxanthin molecules in specific orientations. Based on structural studies of related FCP proteins in diatoms such as Phaeodactylum tricornutum, each FCP monomer binds approximately nine chlorophyll molecules and five fucoxanthin molecules . The spatial arrangement of these pigments enables efficient energy transfer, with each fucoxanthin molecule positioned in close proximity to chlorophyll a to facilitate excitation energy transfer . Unlike LHCs of higher plants, FCPs have evolved unique binding sites for fucoxanthin and chlorophyll c, reflecting their specialized role in marine photosynthesis.

What is the taxonomic distribution of FCPD among photosynthetic organisms?

FCPD is primarily found in organisms with complex red plastids, particularly diatoms, haptophytes, and brown algae (Phaeophyceae). These organisms are collectively responsible for a substantial portion of global primary productivity in marine ecosystems. The evolutionary history of FCPs reflects the complex endosymbiotic events that gave rise to these algal lineages. Genomic analyses reveal that different algal taxa have developed specialized subclasses of FCP proteins. For instance, classification of the lhcf family indicates distinct groups specific to haptophytes, diatoms, and seaweeds . In the haptophyte Tisochrysis lutea, researchers have identified a large family of 52 lhc genes encoding various FCP proteins . This diversification suggests evolutionary adaptation to specific ecological niches and photosynthetic requirements.

What are the optimal expression systems for producing recombinant FCPD?

For recombinant FCPD production, bacterial expression systems using E. coli have proven effective, particularly when the protein is fused to affinity tags for purification. Based on established protocols for similar FCPs, expression constructs typically incorporate the mature protein sequence (excluding transit peptides) fused to an N-terminal His-tag . The recombinant FCPF protein (Q41094), spanning amino acids 32-197, provides a useful reference model for FCPD expression .

For functional studies requiring proper pigment binding, heterologous expression in eukaryotic systems may be preferable. When designing expression constructs, researchers should consider:

  • Codon optimization for the host organism

  • Selection of appropriate tags that don't interfere with folding or pigment binding

  • Inclusion of appropriate transit sequences if targeting to chloroplasts is desired

  • Growth conditions that minimize formation of inclusion bodies

For challenging constructs, cell-free expression systems offer an alternative approach, particularly when rapid screening of multiple constructs is necessary.

What purification protocols yield highest structural integrity of FCPD?

Purification of recombinant FCPD requires careful consideration of protein-pigment interactions. A methodological approach should include:

  • Initial purification using affinity chromatography (typically Ni-NTA for His-tagged constructs)

  • Buffer optimization to maintain pigment association (typically including mild detergents)

  • Size exclusion chromatography to isolate monomeric vs. oligomeric forms

  • Quality control assessment using absorption spectroscopy to verify pigment binding

For structural studies, additional purification steps may be necessary, including ion exchange chromatography to achieve homogeneity required for crystallization trials. Throughout all purification steps, samples should be protected from excessive light exposure and oxidation to preserve the integrity of bound pigments.

How can researchers effectively reconstitute purified FCPD with its native pigments?

Reconstitution of FCPD with its native pigments presents significant challenges due to the hydrophobic nature of both the protein and pigments. A successful methodology involves:

  • Extraction of pigments (chlorophyll a, chlorophyll c, and fucoxanthin) from algal sources using acetone or similar solvents

  • Quantification of pigment concentrations using HPLC with established extinction coefficients

  • Controlled addition of pigments to detergent-solubilized FCPD at specific molar ratios

  • Removal of excess unbound pigments through sucrose gradient centrifugation

The success of reconstitution can be verified through absorption spectroscopy, comparing the spectra to those of native FCPs isolated directly from algal thylakoids. Researchers should optimize pigment:protein ratios, as excess pigments can form aggregates that complicate analysis.

What spectroscopic methods are most informative for analyzing FCPD-pigment interactions?

Multiple complementary spectroscopic techniques provide insights into FCPD-pigment interactions:

  • Absorption Spectroscopy: Provides the basic pigment composition profile, with characteristic peaks for chlorophyll a (around 430 and 665 nm), chlorophyll c (around 450 and 630 nm), and fucoxanthin (around 490 nm). The exact peak positions shift depending on the protein environment .

  • Circular Dichroism (CD): Reveals information about pigment-pigment interactions within the protein scaffold and can detect conformational changes in the protein structure.

  • Time-Resolved Fluorescence: Measures energy transfer rates between pigments, crucial for understanding the excitation energy flow from fucoxanthin to chlorophylls.

  • Transient Absorption Spectroscopy: Provides detailed information about energy transfer pathways and timescales, critical for understanding how FCPD contributes to photosynthetic efficiency.

The close spatial arrangement of fucoxanthin and chlorophyll a molecules within FCPD facilitates efficient energy transfer. Studies on related FCPs indicate that this proximity enables rapid excitation energy transfer and dissipation, essential for both light harvesting and photoprotection .

How can researchers investigate FCPD integration into thylakoid membranes?

FCPD integration into thylakoid membranes can be studied using in vitro import assays, similar to those established for other FCPs. The experimental approach should include:

  • Isolation of intact thylakoids from algal or plant sources

  • Preparation of radiolabeled or fluorescently tagged FCPD precursor proteins

  • Incubation of precursors with isolated thylakoids under varying conditions

  • Analysis of integration using protease protection assays and membrane fractionation

Research has demonstrated that FCP integration into thylakoid membranes depends on stromal factors and GTP, indicating involvement of a signal recognition particle (SRP) pathway similar to that used by LHCs in higher plants . Interestingly, diatom FCPs can integrate into thylakoids of higher plants and vice versa, supporting the hypothesis of a common evolutionary origin for these light-harvesting proteins . This conservation of integration mechanisms provides valuable experimental flexibility, allowing researchers to use more tractable plant systems for some studies of FCPD membrane integration.

What analytical techniques best determine pigment stoichiometry in purified FCPD?

Accurate determination of pigment stoichiometry in FCPD requires multiple complementary approaches:

  • HPLC Analysis: High-performance liquid chromatography with diode array detection (HPLC-DAD) provides the most reliable quantification of individual pigments. Established protocols utilize C8 reverse-phase columns with appropriate solvent gradients .

  • Absorption Spectroscopy with Gaussian Deconvolution: Software-assisted spectral deconvolution can separate overlapping absorption bands of different pigments.

  • Pyridine Hemochrome Assay: Specifically for accurate chlorophyll quantification relative to protein content.

For HPLC analysis, researchers should follow established extraction methods using 95% acetone with mechanical disruption (e.g., mixer-mill with glass beads) followed by filtration through 0.2-μm PTFE filters before injection . Pigment identification requires comparison with authentic standards and characteristic absorption spectra. Based on studies with related FCPs, researchers should anticipate approximately nine chlorophyll molecules and five fucoxanthin molecules per FCPD monomer .

How do nitrogen availability and light conditions regulate FCPD expression?

Nitrogen availability and light conditions significantly impact FCPD expression, as observed with other FCPs. RNA-seq analysis of the haptophyte Tisochrysis lutea revealed dynamic regulation of lhc genes under different nitrogen and light conditions . Specifically:

  • Nitrogen Depletion: Typically causes decreased expression of lhc genes encoding FCP proteins, including those similar to FCPD .

  • Light Intensity: Higher light intensities generally reduce FCP expression, while low light promotes increased expression to maximize light harvesting efficiency.

  • Light Quality: The spectral composition of light can alter the relative expression of different FCP isoforms, reflecting adaptation to specific light environments.

  • Diurnal Patterns: Some FCP proteins show distinct diurnal expression patterns. For example, T. lutea lhcx2 is expressed only at night, suggesting a role in protecting cells from light after prolonged darkness .

To study these regulatory mechanisms, researchers should implement controlled culture systems such as turbidostats or chemostats that allow precise manipulation of nitrogen availability and light conditions while controlling for other variables . This approach helps distinguish direct effects from secondary consequences such as self-shading in batch cultures.

What role does FCPD play in photoprotection mechanisms of diatoms and related algae?

Although specific information about FCPD's photoprotective role is limited, research on related FCPs provides valuable insights. In diatoms and haptophytes, FCP proteins participate in several photoprotection mechanisms:

  • Xanthophyll Cycle Involvement: FCPs bind diadinoxanthin (Ddx) and diatoxanthin (Dtx), which constitute the xanthophyll cycle in these organisms. Under high light, Ddx is converted to Dtx, which facilitates energy dissipation as heat .

  • Non-Photochemical Quenching (NPQ): Certain FCP proteins, particularly those in the Lhcx family, play direct roles in NPQ, protecting photosystems from excess excitation energy.

  • Reactive Oxygen Species (ROS) Scavenging: Fucoxanthin and other carotenoids bound to FCPs help scavenge harmful ROS generated during photosynthesis.

The interrelationship between the photoprotective xanthophyll cycle and fucoxanthin biosynthesis represents a central regulatory hub in these organisms . Knockout studies in Phaeodactylum tricornutum demonstrate that disruption of enzymes involved in this pathway (such as VDL2 and ZEP1) leads to algae lacking fucoxanthin, which appear green rather than brown and show reduced levels of chlorophylls c1 and c2 .

How do post-translational modifications affect FCPD function and stability?

Post-translational modifications (PTMs) of FCP proteins, including FCPD, represent an important but under-explored area of research. Based on studies of related light-harvesting proteins, several types of PTMs likely influence FCPD function:

  • Phosphorylation: Potentially regulates association with photosystems and participation in state transitions.

  • Acetylation: May affect protein stability and pigment-binding properties.

  • Lipid Modifications: Could influence membrane integration and protein-protein interactions within thylakoids.

To investigate PTMs, researchers should employ:

  • Phosphoproteomic approaches using titanium dioxide enrichment

  • Mass spectrometry with multiple fragmentation techniques

  • Site-directed mutagenesis of potential modification sites

These modifications likely represent important regulatory mechanisms for fine-tuning photosynthetic performance in response to changing environmental conditions. The rapid reversibility of many PTMs provides a mechanism for cellular responses that is faster than transcriptional regulation.

What CRISPR-Cas9 strategies are most effective for studying FCPD function through gene editing?

CRISPR-Cas9 gene editing offers powerful approaches for studying FCPD function in vivo. Based on successful strategies used with other FCP genes, researchers should consider:

  • Knockout Approach: Complete disruption of the FCPD gene through homology-directed insertion of a selectable marker (e.g., Ble conferring zeocin resistance) has proven effective for other FCPs . Visual screening can leverage the distinctive color change from brown to green when fucoxanthin synthesis or binding is disrupted .

  • Domain Swapping: Targeted replacement of specific domains to create chimeric proteins that can reveal functional regions.

  • Promoter Editing: Modification of regulatory elements to alter expression patterns while maintaining protein sequence.

  • Point Mutations: Introduction of specific amino acid changes at putative pigment-binding sites to examine their importance.

For diatoms like Phaeodactylum tricornutum, which possess a diploid genome, researchers must consider the need to modify both alleles for complete knockout . PCR validation and sequencing are essential to confirm successful editing, as transformation efficiency for complete knockouts may be relatively low compared to the total number of transformants .

How can cryo-electron microscopy advance our understanding of FCPD structure and interactions?

Cryo-electron microscopy (cryo-EM) represents a transformative approach for studying FCPD structure at high resolution without the need for crystallization. Recent advances with related FCP complexes in diatoms highlight several important considerations:

  • Sample Preparation: Detergent choice is critical for maintaining native oligomeric states while providing suitable contrast for imaging.

  • Data Collection Strategy: Different FCP supercomplexes associate with either photosystem I or photosystem II (PSI-FCPI and PSII-FCPII) with distinct binding patterns of pigments .

  • Computational Analysis: Classification approaches can distinguish between different oligomeric states and associated photosystems.

  • Pigment Modeling: Accurate placement of chlorophylls and fucoxanthin molecules requires careful interpretation of density maps.

Cryo-EM studies of diatom FCP proteins have revealed crucial details about pigment organization, showing that each fucoxanthin molecule is positioned near a chlorophyll a molecule, enabling efficient energy transfer and dissipation . Similar approaches applied to FCPD would provide unprecedented insights into its structure-function relationships.

What computational models best predict pigment-protein interactions in FCPD?

Computational modeling of pigment-protein interactions in FCPD requires sophisticated approaches that account for the unique properties of both the protein and its associated pigments:

  • Homology Modeling: Initial structure prediction based on related FCP proteins with known structures, such as those from Phaeodactylum tricornutum .

  • Molecular Dynamics Simulations: Exploration of pigment-protein dynamics in a lipid bilayer environment, requiring specialized force fields for the conjugated systems of chlorophylls and carotenoids.

  • Quantum Mechanical Calculations: Essential for accurately modeling excitation energy transfer between pigments, particularly the unique properties of fucoxanthin.

  • Binding Site Prediction: Computational identification of potential binding sites through analysis of conserved residues and protein cavities.

Based on analyses of related FCPs, researchers should focus on identifying conserved amino acid residues likely involved in binding specific chlorophyll and fucoxanthin molecules. Studies in P. tricornutum have identified nine binding sites for chlorophylls a and c, along with seven binding sites for fucoxanthin among Lhcf sequences . These sites serve as valuable starting points for computational modeling of FCPD-specific interactions.

How did FCPD evolve relative to other light-harvesting proteins across photosynthetic lineages?

The evolutionary history of FCPD reflects the complex endosymbiotic events that gave rise to diverse algal lineages with red-derived plastids. Comparative genomic analyses reveal several key evolutionary patterns:

  • Common Ancestry: FCPs and LHCs share a common ancestral origin despite binding different pigments, as evidenced by their similar membrane integration mechanisms .

  • Gene Duplication and Diversification: The fucoxanthin biosynthetic pathway evolved through repeated duplication and neofunctionalization of genes for xanthophyll cycle enzymes, specifically violaxanthin de-epoxidase (VDE) and zeaxanthin epoxidase (ZEP) .

  • Lineage-Specific Adaptations: Different algal groups show distinct adaptations in their FCP repertoires. For instance, brown algae (Phaeophyceae) lack some genes present in diatoms and haptophytes and appear to use an alternative pathway for fucoxanthin biosynthesis involving fewer enzymes .

  • Classification Patterns: Analysis of the lhcf family reveals group-specific patterns, with distinct clades for haptophytes, diatoms, and seaweeds .

This evolutionary diversification reflects adaptation to different light environments and ecological niches, contributing to the success of these photosynthetic organisms in marine ecosystems.

What comparative functional analyses between FCPD and other FCPs reveal about specialization?

Comparative functional analyses between different FCP proteins reveal specialized roles within the photosynthetic apparatus:

  • Photosystem Association: Different FCP proteins preferentially associate with either photosystem I or photosystem II, forming distinct supercomplexes (PSI-FCPI and PSII-FCPII) with different pigment binding patterns .

  • Stress Responses: Certain FCP isoforms show specific expression patterns under stress conditions. For example, some Lhcx proteins are specifically upregulated under high light stress and contribute to photoprotection .

  • Diurnal Regulation: Some FCP proteins show distinct diurnal expression patterns, such as T. lutea lhcx2 which is expressed only at night .

  • Pigment Binding Preferences: Subtle differences in protein sequence lead to variations in pigment binding sites, potentially optimizing each FCP for specific light harvesting or photoprotective functions.

Understanding these specialized roles requires integrated analysis combining structural studies, expression patterns, and functional characterization across multiple experimental conditions and algal species.

How does the membrane integration mechanism of FCPD compare to that of LHCs in higher plants?

The membrane integration mechanism of FCPD and other FCPs shows remarkable conservation with that of LHCs in higher plants, despite their evolutionary distance and different pigment binding properties:

  • SRP-Dependent Pathway: Both FCPs and LHCs utilize a signal recognition particle (SRP)-dependent pathway for thylakoid membrane integration, requiring stromal factors and GTP .

  • Presequence Characteristics: FCP preproteins have a bipartite presequence necessary for transport into the four membrane-bound diatom plastids, but like LHCs, they apparently lack a specific presequence for thylakoid membrane targeting .

  • Cross-Species Integration: Remarkably, diatom FCPs can integrate into thylakoids of higher plants and vice versa, demonstrating functional conservation of the integration machinery .

  • Evolutionary Implications: This shared integration mechanism provides strong support for the common evolutionary origin of these light-harvesting protein families .

This conservation of membrane integration pathways across diverse photosynthetic lineages represents a fundamental aspect of chloroplast biology that has been maintained despite the extensive diversification of the proteins themselves.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.