Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FCPE; FPC3; Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-197
Protein Length
Full Length of Mature Protein
Species
Phaeodactylum tricornutum (Diatom)
Target Names
FCPE
Target Protein Sequence
AFENELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLVQENGIRLP GDIDYSGTSFESIPNGFAALTTISGAGIAQIVAFIGFLELAVMKDITGGEFVGDFRNDFI DFGWDSFDEETKMQKRAIELNQGRAAQMGILALMVHEQLGVSLIPN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy transfer proceeds from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, where it fuels ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is Fucoxanthin-Chlorophyll a-c Binding Protein E and how does it differ from other FCP variants?

Fucoxanthin-Chlorophyll a-c Binding Protein E (FCPE) belongs to a family of light-harvesting proteins found in the chloroplasts of diatoms and other chromophytic algae. Similar to its related protein FCPF, FCPE functions in the photosynthetic light-harvesting complex, specifically binding fucoxanthin and chlorophylls a and c to capture light energy for photosynthesis . FCPE differs from other FCP variants primarily in its amino acid sequence and binding properties, which influence its specific role in the photosynthetic apparatus. The protein forms part of the complex that gives diatoms their characteristic brown color, as opposed to the green color of higher plants.

FCPs are crucial for efficient light harvesting, particularly in capturing green light wavelengths that are poorly absorbed by chlorophyll. This capability is conferred by fucoxanthin, which contains a carbonyl group as part of its conjugated double-bond system, responsible for the strongly red-shifted absorbance that enables efficient capture of green light within the FCP complex . The specific binding properties of FCPE may optimize light harvesting under particular environmental conditions or developmental stages that differ from those where other FCP variants predominate.

How do FCPs contribute to photosynthetic efficiency in diatoms?

FCPs play a critical role in diatom photosynthesis by expanding the light absorption spectrum beyond what would be possible with chlorophyll alone. In diatoms, the loss of fucoxanthin results in a reduced functional antenna size associated with Photosystem II (σPSII), demonstrating the importance of this pigment and its binding proteins in facilitating photosynthesis . The FCP complexes function analogously to the Light-Harvesting Complex (LHC) proteins in higher plants but are specialized for the marine environment.

The integration of fucoxanthin into FCP complexes allows diatoms to efficiently utilize the blue-green light that penetrates deeper into water columns, providing an ecological advantage in marine environments. Experimental data from mutant diatom lines shows that disruption of the fucoxanthin biosynthetic pathway not only reduces fucoxanthin content but also affects chlorophyll c levels, suggesting a coordinated biosynthesis and incorporation of these pigments into the FCPs . This coordination underscores the sophisticated evolutionary adaptations of diatoms to their ecological niche and highlights the integral role of FCPs in maintaining photosynthetic efficiency under variable light conditions.

What are the optimal methods for recombinant expression of FCPE protein?

Recombinant expression of FCPE typically employs prokaryotic systems such as Escherichia coli, similar to the approach used for FCPF . For successful expression, researchers should consider using a codon-optimized sequence that accounts for the difference in codon usage between the source organism (typically a diatom like Phaeodactylum tricornutum) and the expression host. The addition of affinity tags, such as a polyhistidine (His) tag, facilitates downstream purification using immobilized metal affinity chromatography (IMAC) .

Expression optimization requires careful consideration of several parameters. Induction conditions, including IPTG concentration, temperature, and duration, should be systematically tested to maximize protein yield while maintaining proper folding. Lower induction temperatures (16-20°C) often improve the solubility of recombinant proteins. Since FCPE is normally located in the chloroplast and binds pigments, expression of the mature protein (without the transit peptide) is recommended. Researchers should verify successful expression through SDS-PAGE and Western blotting using antibodies against the affinity tag or the protein itself. For functional studies, in vitro reconstitution with purified pigments may be necessary to obtain a protein with native-like properties.

How can researchers effectively design experiments to study FCPE function in diatoms?

Designing effective experiments to study FCPE function requires adherence to fundamental principles of good experimental design. Researchers should build on previous research, clearly describe all steps in their procedures, specify the data to be collected, control variables appropriately, include proper controls, use appropriate study subjects, ensure adequate sample size, design for reproducibility, and respect ethical considerations when working with biological systems .

For genetic manipulation studies, CRISPR-Cas9-mediated gene editing has proven effective in diatoms such as P. tricornutum . When designing such experiments, researchers should include multiple independent mutant lines to control for off-target effects. Complementation experiments, where the wild-type gene is reintroduced into mutant lines, provide crucial validation that observed phenotypes result from the targeted gene disruption rather than unintended mutations . Phenotypic analysis should include both pigment composition assessment (via HPLC) and functional measurements such as photosynthetic efficiency. The use of appropriate controls is particularly important—wild-type strains maintained under identical conditions provide the baseline for comparison, while complemented lines help confirm gene function specificity .

What analytical techniques are most appropriate for characterizing FCPE-pigment interactions?

Characterization of FCPE-pigment interactions requires a combination of biochemical, spectroscopic, and structural biology approaches. High-Performance Liquid Chromatography (HPLC) is essential for quantitative analysis of pigment composition and can identify changes in fucoxanthin and chlorophyll c content associated with FCPE function . For detailed binding studies, researchers should combine HPLC with absorption spectroscopy to analyze both the pigment composition and the spectral properties of the protein-pigment complexes.

Circular dichroism (CD) spectroscopy provides valuable information about the protein's secondary structure and how it changes upon pigment binding. Fluorescence spectroscopy, including time-resolved measurements, can reveal energy transfer dynamics within the protein-pigment complex. For structural characterization, X-ray crystallography or cryo-electron microscopy may be employed to determine the three-dimensional arrangement of the protein and its bound pigments. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative binding parameters such as association constants and binding stoichiometry. Researchers should consider using reconstitution experiments with purified components to systematically investigate specific protein-pigment interactions under controlled conditions.

How does FCPE expression vary under different light conditions and what are the methodological approaches to study this variation?

FCPE expression likely varies in response to changing light conditions as part of the photoacclimation strategy in diatoms. To study this variation, researchers should employ a combination of transcriptomic, proteomic, and functional approaches. RNA sequencing (RNA-Seq) can quantify changes in FCPE transcript levels under different light intensities, spectral qualities, or photoperiods. For accurate results, researchers must establish carefully controlled light environments using specialized growth chambers with defined spectral output and intensity.

Protein-level analysis through quantitative proteomics, such as iTRAQ or SILAC, can reveal whether transcriptional changes translate to altered protein abundance. Researchers should complement these molecular approaches with functional measurements of photosynthetic parameters, including oxygen evolution rates, chlorophyll fluorescence, and P700 absorbance changes. Time-course experiments are particularly valuable for distinguishing between short-term responses (which may involve post-translational modifications) and long-term acclimation (involving changes in gene expression). Comparative studies across different diatom species can provide insights into the evolutionary conservation of light-responsive regulation of FCPE expression. When designing such experiments, researchers must standardize culture conditions beyond light, including temperature, nutrient availability, and cell density, to isolate the specific effects of light variation .

What role does FCPE play in photoprotection mechanisms of diatoms under high light stress?

FCPE likely contributes to photoprotection mechanisms that help diatoms manage excess light energy and prevent photodamage. To investigate this role, researchers should design experiments that expose diatom cultures to high light stress while monitoring physiological responses. Pulse-amplitude modulated (PAM) fluorometry provides real-time measurements of photosynthetic parameters, including non-photochemical quenching (NPQ), which reflects thermal dissipation of excess energy. Researchers can compare NPQ capacity in wild-type diatoms versus those with altered FCPE levels through genetic manipulation.

The molecular mechanisms underlying FCPE's photoprotective function may involve interactions with diadinoxanthin cycle pigments. High light conditions typically trigger the conversion of diadinoxanthin to diatoxanthin, which facilitates energy dissipation . Researchers should employ HPLC analysis to track pigment conversions under high light exposure and investigate whether FCPE binding properties change during this process. Protein-protein interaction studies, using techniques such as co-immunoprecipitation or proximity labeling, can identify whether FCPE associates with other proteins under high light conditions, potentially forming photoprotective complexes. Time-resolved spectroscopy can reveal changes in energy transfer pathways that may redirect excitation energy away from reaction centers during high light stress. These multifaceted approaches will help elucidate FCPE's specific contributions to the remarkably effective photoprotection mechanisms that allow diatoms to thrive in fluctuating light environments.

How can CRISPR-Cas9 gene editing be applied to study FCPE function in diatoms?

CRISPR-Cas9 gene editing offers a powerful approach to investigate FCPE function through targeted gene disruption or modification. When applying this technique to study FCPE in diatoms, researchers should design guide RNAs with high specificity for the FCPE gene while minimizing potential off-target effects. The strategy employed for P. tricornutum in studying related photosynthetic genes provides an effective template—researchers achieved gene disruption through homology-directed insertion of a selectable marker (Ble) into the target gene . This approach enables selection of successfully edited cells on antibiotic-containing media.

For comprehensive functional analysis, researchers should generate multiple independent mutant lines and thoroughly characterize their genotypes through PCR and sequencing. Phenotypic screening can leverage the distinctive pigmentation of diatoms—successful disruption of genes in the fucoxanthin pathway results in a color change from brown to green . Complementation experiments, where the wild-type FCPE gene is reintroduced into mutant lines, are essential to confirm that observed phenotypes directly result from FCPE disruption rather than off-target effects . Researchers should combine genetic analysis with biochemical characterization (pigment composition by HPLC) and functional measurements (photosynthetic efficiency parameters) to fully elucidate FCPE's role. This multi-level analysis approach provides robust evidence for gene function while controlling for potential artifacts associated with genetic manipulation techniques.

What approaches can be used to investigate the assembly and trafficking of FCPE within diatom cells?

Investigating FCPE assembly and trafficking requires techniques that visualize protein localization and movement within the complex compartmentalization of diatom cells. Fluorescent protein tagging, using proteins such as GFP or mCherry fused to FCPE, enables live-cell imaging of protein localization. When designing such constructs, researchers should consider tag placement carefully—C-terminal tagging may be preferable if N-terminal transit peptides are important for proper targeting. Expression of these constructs can be achieved through biolistic transformation or electroporation, followed by selection of stable transformants.

Immunogold electron microscopy offers higher-resolution localization data that can distinguish between different chloroplast sub-compartments. For temporal analysis of FCPE trafficking, pulse-chase experiments combined with subcellular fractionation can track newly synthesized protein through different cellular compartments. Researchers can apply inhibitors of specific trafficking pathways to determine the mechanisms involved in FCPE transport. Protein-protein interaction studies, using techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity-dependent biotin identification (BioID), can identify chaperones or other factors that facilitate FCPE folding and assembly with pigments. To directly study import mechanisms, researchers can develop in vitro chloroplast import assays using isolated diatom chloroplasts and radiolabeled or fluorescently labeled FCPE precursors. These complementary approaches provide a comprehensive view of the complex processes governing FCPE localization and integration into functional light-harvesting complexes.

How does FCPE structure and function compare across different diatom species and other photosynthetic organisms?

Comparative analysis of FCPE across species provides valuable insights into evolutionary adaptation of photosynthetic mechanisms. Researchers investigating this question should combine sequence analysis, structural studies, and functional characterization across diverse species. Phylogenetic analysis of FCPE sequences from different diatom species, along with homologous proteins from other chromophytic algae, can reveal evolutionary relationships and identify conserved domains likely critical for function. Computational approaches, including homology modeling based on available FCP structures, can predict structural differences that may correlate with ecological adaptations.

Experimental approaches should include recombinant expression of FCPE from different species, followed by comparative biochemical characterization. Researchers can analyze pigment binding specificity, absorption properties, and protein stability to identify functional differences. Heterologous expression systems, where FCPE from one species is expressed in another, can test functional conservation and identify species-specific factors required for proper function. Comparative spectroscopy of native FCP complexes isolated from different species can reveal adaptations in light-harvesting properties that correlate with their ecological niches. Researchers should integrate these findings with ecological data about the light environments typically experienced by each species to understand how FCPE variation contributes to photosynthetic adaptation. This multi-faceted approach will illuminate how evolutionary processes have shaped FCPE structure and function to optimize photosynthesis across diverse aquatic environments.

What insights can comparative genomics provide about the evolution of FCPE and its role in diatom adaptation to different light environments?

Comparative genomics offers powerful approaches to investigate FCPE evolution and its role in diatom adaptation. Researchers should analyze FCPE gene families across diatom genomes, focusing on gene copy number variation, sequence divergence, and regulatory elements. Many diatoms contain multiple FCP genes that likely arose through gene duplication events, potentially enabling functional diversification and specialization for different environmental conditions. Analysis of selection pressure on different protein domains, using metrics such as dN/dS ratios, can identify regions under positive selection that may contribute to adaptive evolution.

The genomic context of FCPE genes provides additional evolutionary insights. Researchers should examine synteny (conserved gene order) across species to identify ancient versus recent duplication events and potential co-evolution with genes involved in pigment biosynthesis or photosynthetic regulation. Transcriptomic data comparing FCPE expression across species under standardized light conditions can reveal conserved and divergent regulatory mechanisms. Researchers can correlate genomic findings with ecological data about the light environments typically inhabited by different diatom species—those from deeper water columns may show adaptations for efficient capture of blue-green light, while those from fluctuating light environments may have evolved enhanced regulatory flexibility. Integration of these genomic approaches with biochemical and functional analyses creates a comprehensive picture of how FCPE has evolved as part of the remarkable photosynthetic adaptations that have contributed to the ecological success of diatoms across diverse aquatic environments.

What are the main challenges in purifying native FCPE complexes from diatoms and how can they be addressed?

Purification of native FCPE complexes presents significant challenges due to their membrane association and pigment binding properties. The primary difficulty lies in maintaining the integrity of protein-pigment interactions throughout extraction and purification procedures. Researchers should begin with careful cell disruption methods that preserve membrane structures—gentle mechanical disruption in buffer containing glycerol often proves more effective than harsh sonication or detergent treatment. The choice of detergent for solubilization is critical; mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin better preserve native interactions compared to more aggressive detergents.

Throughout purification, researchers must protect samples from light exposure and oxidation, as the bound pigments are highly photosensitive. Working under green safe light and including antioxidants such as ascorbate in all buffers helps prevent pigment degradation. Temperature control is equally important—all procedures should be conducted at 4°C or lower to minimize protein denaturation and pigment loss. For chromatographic separation, researchers should consider using sucrose density gradient centrifugation as an initial step to separate different photosynthetic complexes, followed by ion exchange chromatography and size exclusion chromatography for further purification. Quality control at each step using absorption spectroscopy and pigment analysis helps monitor complex integrity. Researchers should verify the purity and composition of final preparations through a combination of SDS-PAGE, native gel electrophoresis, and mass spectrometry. These methodological refinements collectively enable isolation of native FCPE complexes that retain their structural and functional properties for subsequent biochemical and biophysical characterization.

How can researchers overcome the challenges in correlating in vitro findings about FCPE with its in vivo functions?

Bridging the gap between in vitro findings and in vivo functions represents a significant methodological challenge in FCPE research. To address this challenge, researchers should implement multi-level validation approaches that connect molecular interactions to cellular physiology. A key strategy involves developing in vivo imaging techniques that visualize FCPE localization and dynamics in living diatom cells. Confocal microscopy of fluorescently tagged FCPE can reveal its distribution patterns, while Förster resonance energy transfer (FRET) measurements can detect protein-protein interactions in the native cellular environment.

How might new structural biology techniques advance our understanding of FCPE and its interactions with other photosynthetic components?

Emerging structural biology techniques offer unprecedented opportunities to elucidate FCPE structure and interactions at atomic resolution. Cryo-electron microscopy (cryo-EM) has revolutionized structural biology by enabling visualization of membrane protein complexes in near-native states without crystallization, making it particularly valuable for studying FCPs within their native lipid environment. Single-particle cryo-EM can determine structures of isolated FCPE complexes, while cryo-electron tomography can visualize FCPE organization within the thylakoid membrane context. These approaches will reveal how FCPE interacts with other photosynthetic components in three-dimensional space.

Complementary techniques provide dynamic and functional insights beyond static structures. Advanced solid-state NMR methods can probe pigment-protein interactions within FCPE complexes and detect conformational changes associated with light harvesting or photoprotection. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions of conformational flexibility and protein interaction surfaces. Time-resolved crystallography and X-ray free-electron laser (XFEL) studies can capture transient states in the light harvesting process, providing insights into energy transfer mechanisms. Integrated structural biology approaches, combining multiple techniques with computational modeling, will create comprehensive models of FCPE structure and function that connect molecular details to photosynthetic efficiency. These structural insights will guide rational engineering of photosynthetic systems for enhanced light harvesting capacity and stress tolerance, with applications in both basic science and biotechnology.

What novel spectroscopic approaches could reveal new insights about energy transfer processes involving FCPE?

Advanced spectroscopic techniques offer powerful tools for investigating the dynamic energy transfer processes mediated by FCPE. Two-dimensional electronic spectroscopy (2DES) can track energy flow through pigment networks with femtosecond time resolution and identify pathways and bottlenecks in the energy transfer process. This technique has already revealed unexpected energy transfer routes in photosynthetic complexes and could identify unique features of FCPE function. Transient absorption spectroscopy with broadband detection capabilities can monitor the fate of excited states across the entire visible spectrum, revealing how energy moves between different pigment pools within the FCPE complex.

Single-molecule spectroscopy eliminates ensemble averaging that can mask important functional heterogeneity. By studying individual FCPE complexes, researchers can identify multiple functional states and transitions between them that would be invisible in bulk measurements. Ultrafast Raman spectroscopy provides complementary information about molecular vibrations coupled to electronic transitions, offering insights into how protein structural dynamics influence energy transfer efficiency. Spatially resolved spectroscopy techniques, such as near-field scanning optical microscopy (NSOM) or stimulated emission depletion (STED) microscopy combined with spectroscopic detection, can map energy transfer processes within photosynthetic membranes with nanometer precision. These approaches will reveal how FCPE contributes to the highly efficient yet flexible energy transfer networks that allow diatoms to thrive across diverse and fluctuating light environments. Integration of experimental spectroscopic data with quantum mechanical calculations will enable development of predictive models for photosynthetic energy transfer that connect molecular structure to functional performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.