Recombinant Fucoxanthin-chlorophyll a-c binding protein F, chloroplastic (FCPF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Fucoxanthin-Chlorophyll a-c Binding Protein F, Chloroplastic (FCPF)

Recombinant Fucoxanthin-chlorophyll a-c binding protein F, chloroplastic (FCPF) refers to a specific type of light-harvesting protein complex found in certain algae and diatoms . These proteins are integral to photosynthesis, the process by which these organisms convert light energy into chemical energy . FCPs are transmembrane light-harvesting proteins that belong to the larger superfamily of LHC (light-harvesting complex) proteins and are well-documented in diatoms .

  • Function FCPs play a crucial role in capturing light energy and transferring it to the photosynthetic reaction centers .

  • Pigment Binding They bind to photosynthetic pigments, including fucoxanthin (Fx), chlorophylls a and c (Chl a/c), diadinoxanthin (Ddx), and diatoxanthin (Dtx) .

  • Light Absorption The spatial arrangement of FCPs and their associated carotenoids gives Chromista organisms a strong capacity to absorb light in the blue-green spectrum, which is the predominant light available in aquatic environments .

2.1. Unique Protein-Protein Interactions

Structural and sequence comparisons highlight unique protein-protein interactions between each FCPI subunit and PSI . These interactions are crucial for the assembly and selective binding mechanisms of FCPI subunits in diatom species .

  • RedCAP (FCPI-1) Among the FCPI subunits, FCPI-1, also known as RedCAP, contains two BCRs in addition to Fxs and Ddxs, which is a unique feature in diatoms . RedCAP is positioned near PsaB, PsaI, and PsaL, interacting with these subunits on both the stromal and lumenal sides .

  • Loop Structure in FCPI-1 A loop structure from Q96 to T116 in FCPI-1 is unique and absent in the other four FCPI subunits. This loop is inserted into a cavity formed by PsaB, PsaI, and PsaL, indicating specific recognition and binding .

Molecular Assembly of FCPIs

The molecular assembly of FCPI subunits in the T. pseudonana PSI-FCPI structure involves protein-protein interactions at both the stromal and lumenal sides .

  • Selective Associations Selective associations of FCPIs with PSI require specific amino acid residues unique to each FCPI. The binding and assembly of each FCPI subunit to PSI are likely determined by the amino acid sequences within the loop regions of the 44 FCPs in T. pseudonana .

Spectroscopic Evidences

Resonance Raman spectra of the light-harvesting fucoxanthin-chlorophyll a/ c-binding proteins (FCPs) of marine diatom Fragilariopsis sp. provide spectroscopic evidence for the characterization of the C a-N marker bands and, thus, of the penta- and hexacoordinated states of chlorophylls a/ c in the FCPs .

  • Raman Spectra Analysis Under 405 and 442 nm Raman excitations, all marker bands of Chl a/ c are observed, and isotope-based assignments provide new information on the structure of Chls a/ c in the FCPs and their interactions with the protein environment .

FCPs in Different Species

Variations in PSI-FCPI structures can occur in response to different growth conditions. For example, the diatom C. gracilis exhibits two distinct PSI-FCPI structures with 16 or 24 FCPI subunits, depending on CO2 concentrations and temperatures .

Data Table: Pigment Composition of PSI-FCPI Supercomplex from T. pseudonana**

ComponentPSI CoreFCPI Subunits (5)
Chlorophyll a9445
Chlorophyll c07
β-Carotenes (BCRs)182
Fucoxanthins (Fxs)015
Diadinoxanthins (Ddxs)07
Zeaxanthin (ZXT)10
[4Fe-4S] Clusters30
Phylloquinones20
Lipid Molecules63

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FCPF; Fucoxanthin-chlorophyll a-c binding protein F, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-197
Protein Length
Full Length of Mature Protein
Species
Phaeodactylum tricornutum (Diatom)
Target Names
FCPF
Target Protein Sequence
AFESELGAQPPLGFFDPLGLVADGDQEKFDRLRYVELKHGRISMLAVVGYLVQENGIRLP GDIDYSGTSFASIPNGFAALSTISTAGIAQIVAFIGFLEIAVMKDITGGEFPGDFRNDYI DFGWDSFDEETQFKKRAIELNQGRAAQMGILALMVHEKLGVSLIPN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. In chromophytic algae, LHC is linked to photosystem II, facilitating energy transfer from fucoxanthin and chlorophyll c to chlorophyll a and the photosynthetic reaction centers. This energy is then utilized for ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is Fucoxanthin-Chlorophyll a/c Binding Protein F (FCPF) and what is its role in photosynthesis?

FCPF is a light-harvesting protein that binds fucoxanthin and chlorophylls a and c, forming part of the photosynthetic machinery in diatoms and other brown-colored algae. The protein's primary function is to capture blue-green light (abundant in marine environments) and transfer the excitation energy to photosystem reaction centers.

FCPs extend the spectral range of photosynthetic light harvesting beyond what chlorophyll alone can capture. The photosystem I (PSI) supercomplex incorporates these proteins to form PSI-FCPI supercomplexes, enabling efficient energy transfer. The unique structure of FCPs allows them to bind fucoxanthin, which contains a carbonyl group as part of its conjugated double-bond system responsible for the strongly red-shifted absorbance that efficiently captures green light .

How does the structure of FCPF differ from light-harvesting complexes in land plants?

FCPF differs significantly from the light-harvesting complexes of land plants in both pigment composition and structural arrangement:

  • Pigment composition: While land plants primarily use chlorophyll a and b, FCPs bind chlorophyll a, chlorophyll c, and fucoxanthin. The absence of chlorophyll b and presence of chlorophyll c is a key distinction .

  • Spectral properties: FCPs can absorb in the green light spectrum (500-550 nm) due to fucoxanthin, whereas land plant light-harvesting complexes absorb primarily in the blue and red regions .

  • Protein structure: High-resolution cryo-electron microscopy studies have revealed unique structural features in the PSI-FCPI supercomplex not found in other photosynthetic lineages .

  • Coordination states: Resonance Raman spectroscopy has shown that chlorophylls in FCPs exist in both penta- and hexacoordinated states, with distinct conformations that affect their interaction with the protein environment .

What is the phylogenetic relationship between different FCP subfamilies?

Phylogenetic analysis of FCPs in the diatom Chaetoceros gracilis has revealed five major subfamilies and one minor subfamily:

  • Lhcr: Associated primarily with PSI-FCPI

  • Lhcf: Found in PSII-FCPII complexes

  • Lhcx: Involved in photoprotection

  • Lhcz: Less well-characterized

  • Lhcq: A novel subfamily that varies in number between species

  • CgLhcr9: A distinct type of Lhcr (minor subfamily)

The Lhcr subfamily, including CgLhcr9 and some Lhcqs, has orthologous proteins across different diatom species, particularly those found in PSI-FCPI structures. In contrast, the Lhcf subfamily appears to be more diversified in each diatom species, suggesting species-specific adaptations to light environments .

This classification is common among various red-lineage algae derived from secondary endosymbiosis of red algae, including Haptophyta, providing insights into the evolutionary history of the red algal lineage .

What expression systems are most effective for producing recombinant FCPF?

Escherichia coli remains the most commonly used expression system for recombinant FCPF production, though with important optimizations required:

Optimal E. coli expression parameters for FCPF:

ParameterRecommended ApproachRationale
Plasmid copy numberMedium copy (p15A origin, ~10 copies/cell)High copy plasmids (pMB1', 500-700 copies/cell) can cause metabolic burden
Promotertrc promoterAchieves ~3-fold higher expression than T7 and 5.5-fold higher than lac promoter
Host strainE. coli BL21Deficient in lon and ompT proteases that can degrade recombinant proteins
Carbon sourceGlycerol rather than glucoseReduces acetate formation and enables higher protein yields
Induction0.1 mM IPTG (for lac/trc/tac promoters)Higher concentrations may increase insoluble fraction

Research shows that the combination of a p15A origin with trc promoter can achieve expression levels of approximately 53 mg/L of recombinant protein, significantly higher than other combinations tested .

Additionally, expression in genome-reduced E. coli strains with minC/minD mutations can be advantageous, as they produce minicells that concentrate recombinant proteins. Studies have shown 2.3 to 8.7-fold enrichment of recombinant proteins in these minicells compared to parental cells .

How can I improve the solubility of recombinant FCPF?

Addressing the solubility challenge for recombinant FCPF requires a multi-faceted approach:

  • Promoter selection: Arabinose-inducible promoters (PBAD) generally result in a lower insoluble fraction compared to stronger promoters like trc or T7 .

  • Expression temperature: Lowering the expression temperature to 16-20°C can significantly improve the folding of FCPF and reduce inclusion body formation.

  • Co-expression strategies: Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can improve folding and solubility.

  • Surface expression approach: For proteins with limited solubility, expression on the bacterial surface using autotransporters can be effective as translation and export are tightly coupled, preventing formation of insoluble aggregates .

  • Solubility tags: Fusion with solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Trx (thioredoxin) can improve solubility, though these must be cleaved for functional studies.

The balance between expression level and solubility is critical. Data shows that even with optimal expression conditions (p15A-trc), approximately 50% of the expressed protein may be insoluble . Therefore, optimizing solubility often requires sacrificing some yield.

What purification strategies are most effective for isolating functional FCPF?

Purification of recombinant FCPF requires careful consideration of the protein's properties and intended use:

Step-by-step purification strategy:

  • Affinity chromatography: For His-tagged FCPF (as in reference ), immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective first step.

  • Size exclusion chromatography (SEC): Critical for separating monomeric from aggregated FCPF, which is essential for functional studies. SEC can also help remove impurities with molecular weights different from FCPF.

  • Ion exchange chromatography: Can be used as an intermediate or polishing step, particularly for removing E. coli proteins with similar molecular weights to FCPF.

Special considerations:

  • Detergent selection: For functional studies, purification in mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin is essential to maintain the structure.

  • Buffer components: Include stabilizing agents like glycerol (10-15%) and reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues.

  • Pigment reconstitution: For studies requiring functional pigment-binding, in vitro reconstitution with purified pigments (chlorophylls a/c and fucoxanthin) may be necessary post-purification.

How can I analyze pigment binding to recombinant FCPF?

Analysis of pigment binding to FCPF requires multiple complementary techniques:

  • High-Performance Liquid Chromatography (HPLC):

    • Can separate and quantify bound pigments (fucoxanthin, chlorophyll a, chlorophyll c1/c2)

    • Typical mobile phase: acetonitrile/methanol/ethyl acetate with 0.1M Tris-HCl (pH 8.0)

    • Allows detection of pigment intermediates and identification of biosynthetic pathway components

  • Resonance Raman Spectroscopy:

    • Provides spectroscopic evidence for characterization of the C-a-N marker bands of chlorophylls a/c

    • Can distinguish between penta- and hexacoordinated states of chlorophylls in FCPF

    • Using 15N-isotope-enriched samples provides definitive assignments of vibrational modes

    • Typically performed with 405 and 442 nm Raman excitations to observe all marker bands of Chl a/c

  • Stark Spectroscopy:

    • Measures the electro-optical properties of fucoxanthin within FCPF

    • Quantifies excited-state dipolar properties (|Δμ⃗|exp)

    • Helps understand the charge-transfer properties that enable efficient light harvesting

    • Research shows that fucoxanthin in FCP exhibits |Δμ⃗|exp values of 5-40 D, with the red-most fucoxanthins showing the largest values (~40 D)

  • Absorbance and Fluorescence Spectroscopy:

    • Characterizes the spectral properties of bound pigments

    • Time-resolved fluorescence spectroscopy at varying pH levels (5.0, 6.5, 8.0) can reveal energy-transfer dynamics

    • Functional antenna size associated with Photosystem II (σPSII) can be measured to assess light-harvesting efficiency

What methods can be used to study the structure-function relationship of FCPF?

Several advanced techniques can elucidate the structure-function relationships of FCPF:

  • Cryo-Electron Microscopy (cryo-EM):

    • Provides high-resolution structural information of FCPs in complex with photosystems

    • Recent studies have used two types of cryo-EM maps: postprocessed maps and denoised maps generated using Topaz

    • Model building typically begins with ModelAngelo followed by manual adjustments with Coot

    • Can distinguish between different pigments (chlorophylls a/c, fucoxanthin, diadinoxanthin) based on density features

    • Resolution achieved in recent studies is sufficient to resolve protein-cofactor coordination

  • Site-Directed Mutagenesis:

    • Identify key residues involved in pigment binding and protein-protein interactions

    • CRISPR-Cas9-mediated homology-directed insertion can be used to generate knockout mutants

    • Complementation studies with native or orthologous genes can verify gene function

  • Molecular Docking and Simulations:

    • Identify potential binding sites for fucoxanthin and chlorophylls

    • Predict how mutations might affect pigment binding

    • Elucidate the molecular mechanisms of energy transfer

    • Has been successfully used to understand neofunctionalization of enzymes involved in fucoxanthin biosynthesis

  • Comparative Genomics/Proteomics:

    • Identify conserved domains across different species

    • Trace evolutionary relationships between different FCP subfamilies

    • Phylogenetic analysis has revealed five major subfamilies (Lhcr, Lhcf, Lhcx, Lhcz, and Lhcq)

How can I assess the energy transfer efficiency in recombinant FCPF?

Energy transfer efficiency in recombinant FCPF can be assessed using these sophisticated approaches:

  • Time-Resolved Fluorescence Spectroscopy:

    • Measures excitation energy dynamics at different time scales

    • Can detect ultrafast energy transfer from fucoxanthin to chlorophyll

    • Studies at different pH values (5.0, 6.5, 8.0) have revealed that diatom FCPs switch function from light-harvesting to energy-quenching via rearrangements of energy-transfer pathways under acidic conditions

    • Typical fluorescence decay components at pH 5.0 show shorter lifetimes than at pH 6.5 and 8.0

  • Transient Absorption Spectroscopy:

    • Provides information on excited state dynamics with femtosecond to nanosecond resolution

    • Can track energy migration pathways from fucoxanthin to chlorophylls and between different chlorophylls

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about the pigment organization and excitonic coupling

    • Changes in CD spectra correlate with structural changes that affect energy transfer efficiency

  • Functional Antenna Size Measurement:

    • Quantifies the light-harvesting efficiency using parameters such as σPSII (functional antenna size associated with Photosystem II)

    • Studies have shown reduced σPSII in mutants lacking fucoxanthin compared to wild-type, demonstrating the importance of fucoxanthin in facilitating photosynthesis

How does the FCPF structure facilitate the unique spectral properties of fucoxanthin?

The FCPF structure has evolved specific features that optimize the spectral properties of fucoxanthin:

  • Polar Binding Environments:
    FCPF provides specific binding pockets with varying polarities that influence the fucoxanthin absorption spectra. The carbonyl group in fucoxanthin's conjugated double-bond system is responsible for its strongly red-shifted absorbance when located in more polar binding environments within the FCPs, enabling efficient capture of green light .

  • Charge-Transfer Properties:
    Stark spectroscopy has revealed that fucoxanthin undergoes significant photoinduced charge transfer (CT) upon excitation. In the protein environment, fucoxanthin exhibits a 17 D change in static dipole moment (|Δμ⃗|exp) for the S0 → S2 transition, with even larger values at the red edge of absorption .

  • Multiple Binding Sites:
    Within FCPF, there appear to be different populations of fucoxanthin molecules with distinct spectral properties. Studies have identified:

    • Fucoxanthins with |Δμ⃗|exp values of approximately 5 D (450-500 nm region)

    • Fucoxanthins with |Δμ⃗|exp values of approximately 15 D (450-500 nm region)

    • Red-most fucoxanthins with extraordinarily large |Δμ⃗|exp values of approximately 40 D, which are particularly efficient in energy transfer to chlorophyll a

  • Hydrogen Bonding Network:
    Resonance Raman spectroscopy has identified two keto carbonyls at 1679 cm⁻¹ (strong H-bonded) and 1691 cm⁻¹ (weak H-bonded) in both 405 and 442 nm Raman spectra, showing that specific hydrogen bonding interactions fine-tune the spectral properties of bound pigments .

These structural features collectively enable the efficient capture of green light and subsequent energy transfer to chlorophylls, providing a significant adaptive advantage in marine environments.

What are the critical differences in FCPF among different groups of algae, and how do they relate to evolutionary adaptation?

FCPF shows significant diversity across different algal groups, reflecting evolutionary adaptations to specific ecological niches:

  • Structural Variations:

    • Diatoms: Have diverse FCPF proteins, particularly in the Lhcf subfamily, suggesting species-specific adaptations to various light environments

    • Haptophytes: Share common FCPF subfamilies with diatoms, but with distinct sequences reflecting their separate evolutionary history

    • Brown algae (Phaeophyceae): Lack diadinoxanthin and certain genes present in diatoms, suggesting they use an alternative pathway for fucoxanthin biosynthesis with fewer enzymes

  • Phylogenetic Distribution:
    Phylogenetic analysis reveals that:

    • The Lhcr subfamily is highly conserved across species, particularly proteins found in PSI-FCPI structures

    • The Lhcf subfamily shows significant diversification between species

    • The number of Lhcq proteins varies among species, potentially contributing to species-specific adaptations

    • The presence of these proteins is strictly confined to algae that harbor the diadinoxanthin cycle and synthesize fucoxanthin

  • Evolutionary Implications:

    • Genes encoding enzymes central to fucoxanthin biosynthesis (ZEP1 and VDL2) evolved by repeated duplication and neofunctionalization of genes for xanthophyll cycle enzymes

    • The pathway to fucoxanthin biosynthesis is more complex than previously anticipated, with diadinoxanthin metabolism serving as a central regulatory hub connecting photoprotection and light harvesting

    • Different groups have evolved distinct solutions: brown algae lack diadinoxanthin and related genes, using an alternative pathway predicted to involve fewer enzymes

  • Functional Adaptation:

    • Diatom and haptophyte FCPFs incorporate regulatory mechanisms that connect light harvesting and photoprotection

    • Studies suggest that under acidic pH conditions, diatom FCPs switch from light-harvesting to energy-quenching function through structural changes in pigment environments

How do the biosynthetic pathways for fucoxanthin and chlorophyll c integrate with FCPF assembly in vivo?

The integration of pigment biosynthesis with FCPF assembly is a complex and highly coordinated process:

  • Coordinated Biosynthesis:

    • Mutant studies have revealed that disruption of fucoxanthin biosynthesis genes (VDL2 or ZEP1) results in parallel loss of both fucoxanthin and chlorophylls c1/c2, suggesting highly coordinated biosynthesis and incorporation of these pigments into FCPs

    • Complementation of mutants with native genes restores both fucoxanthin biosynthesis and accumulation of chlorophyll c1/c2

  • Biosynthetic Pathway Regulation:

    • The fucoxanthin biosynthetic pathway is more complex than previously thought, involving multiple enzymes

    • Diadinoxanthin serves as a central regulatory hub connecting:
      a) Photoprotective xanthophyll cycle (conversion to diatoxanthin under high light)
      b) Formation of fucoxanthin for light harvesting under limiting light

    • The pathway evolved through duplication and neofunctionalization of genes for xanthophyll cycle enzymes (violaxanthin de-epoxidase and zeaxanthin epoxidase)

  • Key Enzymes and Intermediates:

    • ZEP1 and VDL2 are central enzymes in diatoms and haptophytes

    • CRTISO5, a protein predicted to be from a family of carotenoid isomerases, has gained a novel function in diatoms - it catalyzes the final step of fucoxanthin biosynthesis

    • CRTISO5 converts phaneroxanthin into fucoxanthin by hydrating its carbon-carbon triple bond, rather than functioning as an isomerase

  • Assembly Integration:

    • The loss of light-harvesting pigments affects the functional antenna size associated with Photosystem II (σPSII), demonstrating the importance of proper pigment incorporation for photosynthetic function

    • pH influences excitation-energy-relaxation processes in FCPs, suggesting environmental regulation of the assembled complex function

  • Evolutionary Conservation:

    • Genes encoding ZEP1 and VDL2 are strictly confined to algae that harbor the diadinoxanthin cycle and synthesize fucoxanthin

    • Complementation studies between species (e.g., expression of haptophyte genes in diatom mutants) successfully restore fucoxanthin biosynthesis, indicating conservation of the pathway across these groups

What are the most promising approaches for engineering enhanced photosynthetic efficiency using recombinant FCPF?

Engineering enhanced photosynthetic efficiency using recombinant FCPF presents several promising approaches:

  • Heterologous Expression of Complete Light-Harvesting Systems:

    • Recent work has demonstrated that a complete chlorophyll biosynthetic pathway can be expressed in E. coli, turning cells green

    • A similar approach could be developed for expressing the complete fucoxanthin-chlorophyll a/c biosynthetic pathway and FCPF proteins

    • This would require expression of at least 12-15 genes, including:

      • Fucoxanthin biosynthesis genes (including ZEP1, VDL2, and CRTISO5)

      • Chlorophyll c biosynthesis genes

      • FCPF structural genes

  • Optimizing Spectral Range:

    • Engineering FCPF proteins with modified binding pockets to further enhance green light absorption

    • Creating chimeric proteins that combine features of different FCP subfamilies

    • Directed evolution approaches to select for variants with enhanced spectral properties

    • Targeting the charge-transfer properties of fucoxanthin by modifying the protein environment to enhance |Δμ⃗| values, which have been shown to reach as high as 40 D in red-shifted fucoxanthins

  • Enhancing Stress Tolerance:

    • Engineering the pH-dependent switching mechanism observed in diatom FCPs, which allows them to transition from light-harvesting to energy-quenching functions

    • Incorporating elements of the diadinoxanthin-diatoxanthin cycle for improved photoprotection under high light conditions

    • Designing synthetic regulatory circuits that respond to light intensity and other environmental factors

  • Systems Biology Approach:

    • Integrating the expression of FCPF and associated pigment biosynthesis genes with metabolic modeling

    • Balancing expression levels to minimize metabolic burden while maximizing light-harvesting capacity

    • Research shows that medium copy number vectors (p15A origin, ~10 copies/cell) with intermediate strength promoters (trc) provide optimal expression conditions, suggesting a balanced approach is necessary

  • Structural Engineering Based on Cryo-EM Data:

    • Recent high-resolution structures of PSI-FCPI supercomplexes provide templates for rational design

    • Engineering protein-protein interfaces to optimize assembly and energy transfer

    • Modifying pigment-binding residues based on structural information to enhance binding and spectral properties

How can I address pigment instability during recombinant FCPF studies?

Addressing pigment instability is critical for successful FCPF studies:

  • Prevention Strategies During Extraction and Purification:

    • Perform all procedures under green safe light or dim light conditions

    • Add antioxidants to extraction buffers (5-10 mM sodium ascorbate, 1-2 mM DTT)

    • Maintain cold temperatures (0-4°C) throughout processing

    • Use nitrogen-purged buffers to minimize oxygen exposure

    • Include metal chelators (1 mM EDTA) to prevent metal-catalyzed oxidation

  • Storage Optimization:

    • Store samples at -80°C in light-tight containers

    • For long-term storage, lyophilization under nitrogen atmosphere can be effective

    • Add glycerol (10-15%) as a cryoprotectant for frozen samples

    • Consider storage in the dark under argon atmosphere for maximum stability

  • Analytical Considerations:

    • Regular monitoring of pigment integrity by absorption spectroscopy

    • Account for potential pigment degradation when interpreting results

    • Use internal standards for accurate quantification in HPLC analysis

    • Compare results to freshly extracted pigments from native sources

  • Reconstitution Approaches:

    • In vitro reconstitution with purified pigments can restore function to apo-proteins

    • Optimize pigment:protein ratios to match native conditions

    • Allow sufficient incubation time (typically overnight at 4°C) for proper binding

What strategies can resolve inconsistent or contradictory results in FCPF functional studies?

When faced with inconsistent or contradictory results in FCPF functional studies, consider these methodological approaches:

  • Standardize Experimental Conditions:

    • Control light exposure during all steps, as FCPs are highly light-sensitive

    • Maintain consistent pH conditions, as pH significantly affects energy transfer properties (pH 5.0 shows different behavior than pH 6.5 or 8.0)

    • Use defined buffer compositions and ionic strengths across experiments

    • Standardize protein:pigment ratios in reconstitution experiments

  • Verify Protein Integrity:

    • Confirm proper folding using circular dichroism spectroscopy

    • Assess oligomeric state by native PAGE or size exclusion chromatography

    • Verify pigment binding through absorption and fluorescence spectroscopy

    • Check for proteolytic degradation by SDS-PAGE and mass spectrometry

  • Apply Complementary Techniques:

    • Combine spectroscopic methods (absorption, fluorescence, Raman) for comprehensive characterization

    • Use both in vitro (purified protein) and in vivo (intact cells) approaches

    • Verify results using both steady-state and time-resolved measurements

    • Apply isotope labeling (e.g., 15N) to definitively assign spectral features

  • Control for Expression System Effects:

    • Expression systems significantly impact recombinant protein properties

    • Compare results between different expression strategies:

      • Various promoters (trc, T7, lac) affect expression levels and potentially folding

      • Plasmid copy number influences metabolic burden and protein quality

      • Carbon source selection (glycerol vs. glucose) affects yield and potentially folding

  • Consider Environmental Adaptation:

    • FCP properties vary between species adapted to different light environments

    • Diatom FCPs show pH-dependent switching between light-harvesting and energy-quenching functions

    • The presence of different FCP subfamilies (Lhcr, Lhcf, Lhcx, Lhcz, Lhcq) with different properties may contribute to variability

How can I optimize heterologous expression systems for complete fucoxanthin-chlorophyll biosynthesis?

Optimizing heterologous expression systems for complete fucoxanthin-chlorophyll biosynthesis requires a systematic approach:

  • Operon Design and Gene Organization:

    • Organize genes into functional modules based on biosynthetic pathway steps

    • Balance expression levels through careful promoter and RBS selection

    • Consider using multiple compatible plasmids with different origins of replication

    • Research shows medium copy plasmids (p15A origin) provide better expression than high copy plasmids for many recombinant proteins

  • Pathway Balancing:

    • Identify and address rate-limiting steps in the biosynthetic pathway

    • Modulate expression levels of key enzymes (ZEP1, VDL2, CRTISO5)

    • Implement metabolic flux analysis to identify bottlenecks

    • Consider dynamic regulation systems responsive to metabolite levels

  • Precursor Supply:

    • Ensure adequate supply of pathway precursors

    • Enhance production of protoporphyrin IX for chlorophyll synthesis

    • Optimize carotenoid biosynthesis for fucoxanthin production

    • Consider supplementing culture media with pathway intermediates

  • Host Cell Engineering:

    • Select appropriate host strain (E. coli BL21 or derivatives)

    • Consider genome-reduced strains to decrease metabolic burden

    • Implement minC/minD mutations to produce minicells that concentrate recombinant proteins

    • Knockdown competing metabolic pathways that drain precursors

    • Engineer chloroplast-like compartmentalization for improved pathway efficiency

  • Cofactor Availability:

    • Ensure sufficient supply of cofactors required by biosynthetic enzymes

    • Supplement media with metal ions, ATP, NADPH, and other required cofactors

    • Consider co-expression of enzymes for cofactor regeneration

    • Optimize growth conditions (temperature, aeration) for cofactor production

  • Implementation of Successful Strategies from Related Systems:

    • Apply lessons from the successful expression of complete chlorophyll biosynthesis in E. coli, which required 12 genes and converted endogenous protoporphyrin IX into chlorophyll a

    • Adopt similar modular design principles but incorporate the additional genes required for fucoxanthin synthesis and chlorophyll c production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.