Recombinant Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Fumarate reductase subunit C (frdC) is a component of the fumarate reductase (FRD) enzyme found in Escherichia coli and other organisms . FRD is essential for anaerobic respiration, where it catalyzes the reduction of fumarate to succinate, enabling the organism to grow in the absence of oxygen . The FRD enzyme complex comprises four subunits (FrdA, FrdB, FrdC, and FrdD), with FrdC playing a crucial role in anchoring the catalytic subunits (FrdA and FrdB) to the cytoplasmic membrane .

Role in Anaerobic Respiration

Fumarate reductase (FRD) is a four-subunit enzyme that catalyzes the terminal step in anaerobic respiration to fumarate in E. coli . Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth .

Key Amino Acids in FrdC

Specific amino acid residues in FrdC are critical for its function. For example, the positive charge at FrdCH82 is required for stabilization of the quinone radical intermediate, and the negative charge at FrdCE29 is essential for the deprotonation of menaquinol . Other critical amino acids identified in FrdC include Ala-32, Phe-38, and Trp-86 .

FrdC and FrdD Interaction

FrdC interacts with FrdD, another hydrophobic subunit, to anchor the catalytic subunits . This interaction is vital for maintaining the structural integrity of the FRD complex and ensuring efficient electron transfer .

Mutations in FrdC

Mutations in FrdC can significantly affect the activity of fumarate reductase. For instance, replacing FrdCE29 with Asp, Leu, Lys, or Phe has a deleterious effect on both quinol oxidase and quinone reductase activities . Similarly, substituting FrdCH82 with Arg, Leu, Tyr, or Glu decreases menaquinol oxidase activity .

Recombinant Production

Recombinant FrdC can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells . These recombinant proteins are used for research purposes, such as studying protein structure, function, and interactions .

Functional Partners

ProteinDescription
frdDFumarate reductase (anaerobic), membrane anchor subunit; Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane; Belongs to the FrdD family .
frdBFumarate reductase (anaerobic), Fe-S subunit; Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth .
frdAAnaerobic fumarate reductase catalytic and NAD/flavoprotein subunit; Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth. Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily .
sdhASuccinate dehydrogenase, flavoprotein subunit; Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth .
sdhCSuccinate dehydrogenase, membrane subunit, binds cytochrome b556; Membrane-anchoring subunit of succinate dehydrogenase (SDH); Belongs to the cytochrome b560 family .
sdhBSuccinate dehydrogenase, FeS subunit; Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth .
sdhDSuccinate dehydrogenase, membrane subunit, binds cytochrome b556; Membrane-anchoring subunit of succinate dehydrogenase (SDH) .
sucDSuccinyl-CoA synthetase, NAD(P)-binding, alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. Can use either ATP or GTP, but prefers ATP. It can also function in the other direction for anabolic purposes, and this may be particularly importan .
sucCSuccinyl-CoA synthetase, beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit. Can use either ATP or GTP, but prefers ATP. It can also function in the other direction for anabolic purposes, and this may be particularly impor .
sadSuccinate semialdehyde dehydrogenase, NAD(P)+-dependent; Catalyzes the NAD(+)-dependent oxidation of succinate semialdehyde to succinate. It acts preferentially with NAD as cosubstrate but can also use NADP. Prevents the toxic accumulation of succinate semialdehyde (SSA) and plays an important role when arginine and putrescine are used as the sole nitrogen or carbon sources .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Target Names
frdC
Target Protein Sequence
MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFS ANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIV AWMVLS
Uniprot No.

Q&A

What is fumarate reductase and how does frdC fit into the complex?

Fumarate reductase is a heterotetrameric membrane-bound enzyme complex that catalyzes the reversible reduction of fumarate to succinate. This process is essential in anaerobic respiration and serves as a bridge between the Krebs cycle and oxidative phosphorylation. The complex consists of four subunits: FrdA (catalytic subunit), FrdB (iron-sulfur cluster subunit), and two membrane-anchoring subunits, FrdC and FrdD. Subunit C (frdC) is one of the integral membrane components that plays a crucial role in anchoring the complex to the membrane and facilitating electron transfer through quinone binding sites . The complete fumarate reductase complex contains both soluble domains (subunits A and B) and membrane-bound domains (subunits C and D), with the soluble domain extending into the cytoplasm while the membrane subunits anchor the complex to the cell membrane.

How does frdC differ structurally and functionally from other fumarate reductase subunits?

While subunits A and B are highly conserved across bacteria and mammals, the membrane domain components, including frdC, show significant variation in structure across different organisms. FrdC typically contains 5-6 transmembrane helices and can possess varying numbers of heme groups depending on the organism . Unlike the catalytic FrdA or the electron-transferring FrdB, frdC does not directly participate in the chemical conversion of fumarate to succinate. Instead, its primary functions include: (1) anchoring the entire complex to the membrane, (2) containing quinone binding sites for electron transfer, and (3) potentially harboring heme groups that serve as electron sinks or facilitators in the electron transfer pathway . The variation in frdC structure across species may reflect adaptations to different environmental conditions and respiratory requirements.

What are the key differences between fumarate reductase and succinate dehydrogenase complexes?

Fumarate reductase (FRD) and succinate dehydrogenase (SDH) are structurally and mechanistically similar enzymes that catalyze the redox interconversion of succinate and fumarate . The key differences include:

CharacteristicFumarate Reductase (FRD)Succinate Dehydrogenase (SDH)
Preferred reaction directionFumarate reduction to succinateSuccinate oxidation to fumarate
Physiological contextPredominant in anaerobic conditionsPredominant in aerobic conditions
Electron carrier interactionTypically oxidizes quinolsTypically reduces quinones
Membrane associationIntegral membrane proteinIntegral membrane protein
Expression regulationInduced by anaerobic conditionsInduced by aerobic conditions
Role in metabolismTerminal electron acceptor in anaerobic respirationComponent of TCA cycle and electron transport chain

Despite these differences, both enzymes share similar structural architecture with membrane-bound domains (including subunit C) and soluble catalytic domains . In some organisms with both complexes, each is used preferentially under specific conditions, optimized for their respective reaction directions .

What expression systems are most effective for recombinant frdC production?

For recombinant expression of frdC, E. coli-based systems have proven particularly effective due to their high yield and relative simplicity. Based on experimental evidence with fumarate reductase components, plasmid systems with moderate to high copy numbers, such as pBR322 (approximately 40 copies per cell) or ColE1 derivatives (approximately 20 copies per cell), have shown successful expression . The choice of expression system should consider:

  • The hydrophobic nature of frdC as a membrane protein, which may require specialized expression strategies

  • The potential need for co-expression with other fumarate reductase subunits for proper folding and function

  • The inclusion of affinity tags for purification without disrupting membrane insertion

When expressing frdC alone (without other subunits), it is critical to include appropriate signal sequences to ensure proper membrane targeting. Expression under anaerobic conditions may provide a more native-like environment for proper folding, as demonstrated in studies with complete fumarate reductase complexes .

How can two-dimensional gel electrophoresis be optimized for frdC identification and quantification?

Two-dimensional gel electrophoresis has been successfully applied to identify and quantify fumarate reductase subunits in recombinant strains . For membrane proteins like frdC, standard protocols require significant modifications:

  • Sample preparation: Use specialized detergents (e.g., CHAPS, Triton X-100) at appropriate concentrations to solubilize membrane proteins without denaturing them

  • First dimension (isoelectric focusing): Apply extended equilibration times and gradual voltage ramping to allow complete solubilization and migration

  • Second dimension: Use gradient gels (e.g., 10-20% acrylamide) to accommodate the typically lower molecular weight of frdC

  • Staining: Silver staining or fluorescent dyes offer higher sensitivity for detecting potentially low-abundance membrane proteins

Quantification can be performed using dilution series and standard curves, as demonstrated with other fumarate reductase subunits where the relative subunit abundance was correlated with enzyme activity . When comparing expression levels across different strains or conditions, it is essential to establish consistent loading controls and normalization procedures to account for membrane fraction variability.

What are the recommended methods for measuring fumarate reductase activity in recombinant systems expressing frdC?

The measurement of fumarate reductase activity in systems expressing recombinant frdC should incorporate both in vitro enzyme assays and whole-cell conversion measurements:

In vitro enzyme assays:

  • Membrane fraction isolation through differential centrifugation

  • Spectrophotometric measurement of benzyl viologen oxidation at 578 nm in the presence of fumarate

  • Polarographic oxygen electrode measurements with appropriate electron donors

Whole-cell conversion measurements:

  • Anaerobic incubation of recombinant cells with fumarate and glucose

  • HPLC or enzymatic quantification of succinate and fumarate concentrations

  • Calculation of conversion rates and yields

For comprehensive assessment, both approaches should be employed. Notably, whole-cell assays have demonstrated that succinate production rates in recombinant strains can reach saturation even with increasing enzyme levels, suggesting that membrane capacity for functional enzyme incorporation may be limiting . When working specifically with recombinant frdC, it is advisable to co-express it with other fumarate reductase subunits to form a functional complex for activity measurements.

How does the amplification of frdC impact electron transfer efficiency in fumarate reductase?

The amplification of frdC through recombinant expression has complex effects on electron transfer efficiency that go beyond simple linear relationships. Evidence from studies with amplified fumarate reductase suggests that increases in enzyme concentration do not always correlate with proportional increases in activity . Several factors contribute to this non-linear relationship:

Research has shown that strains with different levels of fumarate reductase amplification (8-fold versus 36-fold) can exhibit similar rates of succinate formation, suggesting a plateau effect . This indicates that optimization of frdC expression should focus not merely on maximizing quantity but on achieving the optimal balance with other subunits and ensuring proper membrane integration to maximize functional electron transfer efficiency.

What are the current contradictions in understanding heme-quinone interactions in frdC, and how might they be resolved?

Several contradictions exist in our understanding of heme-quinone interactions within frdC, particularly regarding the exact electron transfer pathway and the role of heme b:

  • Electron path ambiguity: In some models, electrons flow from [3Fe-4S] clusters to quinone directly, while in others, they pass through heme b as an intermediate . This contradiction may arise from species-specific differences or from technical limitations in measuring rapid electron transfers.

  • Heme b function: While some studies propose heme b serves primarily as an electron sink , others suggest it plays a direct role in quinone reduction. The absence of detectable semiquinone signals during catalysis in some systems challenges the established models of sequential electron transfer .

  • Quinone binding site structure: The precise arrangement of amino acid residues that form the quinone binding site in frdC varies across species, leading to contradictory structure-function relationships.

These contradictions could be resolved through:

  • Combining time-resolved spectroscopic techniques (e.g., stopped-flow spectroscopy, rapid-freeze EPR) to capture transient intermediates

  • Comparative studies across multiple species with different frdC structures

  • Site-directed mutagenesis of key residues in the proposed quinone binding sites

  • Advanced computational modeling of electron transfer kinetics

A systematic approach that addresses the (α, β, θ) parameters of contradiction analysis (where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimum number of Boolean rules needed) could help resolve these discrepancies by formalizing the logical relationships between experimental observations.

How can researchers address the contradiction between in vitro and in vivo activity measurements of recombinant fumarate reductase containing frdC?

Researchers frequently encounter discrepancies between in vitro enzyme assays and whole-cell activity measurements when studying recombinant fumarate reductase. These contradictions require systematic analysis using the following approaches:

  • Identify specific contradiction patterns: Apply a structured notation system similar to the (α, β, θ) parameters described for contradiction analysis in health data . For fumarate reductase, this might involve:

    • α: Number of interdependent factors (enzyme concentration, substrate availability, membrane integration)

    • β: Number of contradictory observations between in vitro and in vivo systems

    • θ: Minimum number of rules needed to explain the contradictions

  • Methodological reconciliation strategies:

    • Perform parallel measurements under identical conditions (temperature, pH, substrate concentrations)

    • Develop correction factors based on membrane permeability to substrates

    • Account for metabolic competition in whole-cell systems

  • Data normalization approaches:

    • Express activity per unit of properly incorporated enzyme rather than total protein

    • Determine the fraction of enzyme in functional vs. non-functional states in each system

    • Account for differences in redox environment between isolated membranes and whole cells

Studies with recombinant strains expressing fumarate reductase have shown that despite higher enzyme levels in certain strains (e.g., JRG1346 vs. JRG1233), succinate formation rates can be similar . This suggests that factors beyond enzyme concentration, such as membrane integration efficiency or metabolic bottlenecks, significantly influence in vivo activity.

What statistical approaches are most appropriate for analyzing the relationship between frdC expression levels and fumarate reductase activity?

The non-linear relationship between frdC expression and fumarate reductase activity requires sophisticated statistical approaches:

  • Non-linear regression models:

    • Michaelis-Menten-type saturation models to account for enzyme-limited vs. substrate-limited regimes

    • Sigmoidal models to capture potential cooperative effects in complex assembly

  • Multivariate analysis:

    • Principal Component Analysis (PCA) to identify key variables influencing activity

    • Partial Least Squares (PLS) regression to handle correlated predictors (e.g., expression levels of multiple subunits)

  • Hierarchical modeling approaches:

    • Mixed-effects models to account for variation between experimental batches

    • Nested designs that separate the effects of enzyme concentration, membrane integration, and catalytic efficiency

When analyzing data from systems with varying levels of frdC expression, it is essential to:

  • Test for deviations from linearity before applying linear statistics

  • Consider power transformations to normalize non-linear relationships

  • Validate statistical models using independent datasets or cross-validation

Research has demonstrated that amplification of fumarate reductase beyond certain levels does not proportionally improve succinate yields , highlighting the importance of appropriate non-linear statistical models for accurate interpretation.

How can researchers disambiguate the effects of frdC mutations from those affecting other fumarate reductase subunits?

Disambiguating the specific effects of frdC mutations from those affecting other subunits requires a structured experimental approach:

  • Genetic complementation strategies:

    • Express wild-type frdC in mutant backgrounds of other subunits

    • Express mutant frdC in wild-type backgrounds

    • Create combinatorial mutation matrices with systematic variation across all subunits

  • Biochemical approaches:

    • In vitro reconstitution with purified components to test specific interactions

    • Cross-linking studies to identify altered subunit interactions

    • Site-specific spectroscopic probes to monitor local structural changes

  • Analytical framework:

    • Apply Boolean minimization techniques similar to those used in contradiction analysis

    • Develop truth tables relating specific mutations to phenotypic outcomes

    • Minimize the number of rules needed to explain experimental observations

This systematic approach allows researchers to determine whether an observed phenotype is directly attributable to frdC mutation or results from altered interactions with other subunits. Evidence suggests that both large and small subunits of fumarate reductase are amplified in recombinant strains , indicating the importance of considering all components when interpreting mutational effects.

What are the most common pitfalls in membrane fraction preparation for recombinant frdC analysis?

Membrane fraction preparation for recombinant frdC analysis presents several challenges that can significantly impact experimental outcomes:

  • Incomplete membrane solubilization:

    • Symptom: Low protein yield and activity

    • Solution: Optimize detergent type, concentration, and solubilization time; consider using detergent mixtures for complex membrane proteins

  • Loss of quaternary structure:

    • Symptom: Reduced activity despite detectable protein

    • Solution: Use milder solubilization conditions; consider digitonin or amphipols as alternatives to harsh detergents

  • Incomplete separation of membrane fractions:

    • Symptom: Contamination with cytoplasmic proteins

    • Solution: Implement additional purification steps; use density gradient centrifugation for cleaner separation

  • Variable membrane protein extraction efficiency:

    • Symptom: Inconsistent results between batches

    • Solution: Standardize cell growth and harvesting conditions; include internal controls for extraction efficiency

When analyzing recombinant strains with amplified fumarate reductase, it's important to note that very high expression levels may lead to both membrane-bound and cytoplasmic forms of the enzyme . This heterogeneity requires careful fractionation and analysis to distinguish between properly incorporated and mislocalized protein.

How can researchers troubleshoot low expression yields of recombinant frdC?

Low expression yields of recombinant frdC can result from multiple factors that require systematic troubleshooting:

  • Transcriptional issues:

    • Verify promoter functionality through reporter gene assays

    • Optimize induction conditions (timing, inducer concentration)

    • Consider alternate promoters with different strength or regulation

  • Translational limitations:

    • Check for rare codons and consider codon optimization

    • Verify ribosome binding site efficiency

    • Test different fusion partners or signal sequences

  • Protein stability concerns:

    • Monitor for degradation through pulse-chase experiments

    • Co-express with potential stabilizing partners (other Frd subunits)

    • Test lower expression temperatures to improve folding

  • Toxicity management:

    • Use tightly regulated expression systems

    • Test lower copy number plasmids

    • Consider inducible systems with minimal basal expression

What strategies can be employed to improve the solubility and membrane integration of recombinant frdC?

Improving solubility and membrane integration of recombinant frdC requires targeted strategies addressing its hydrophobic nature:

  • Co-expression approaches:

    • Express frdC together with frdD, its membrane partner

    • Co-express with appropriate chaperones (e.g., DnaK/DnaJ system)

    • Consider co-expression with lipid biosynthesis enzymes to modify membrane composition

  • Fusion protein strategies:

    • Test N-terminal fusions that don't interfere with membrane insertion

    • Consider split-GFP or split-luciferase systems to monitor membrane localization

    • Implement removable solubility tags with specific proteases

  • Expression condition optimization:

    • Reduce expression temperature to slow folding and membrane insertion

    • Evaluate microaerobic or anaerobic conditions that mimic native expression

    • Modify media composition to support membrane protein production

  • Post-expression handling:

    • Carefully select detergents for solubilization (maltoside detergents often work well)

    • Consider nanodiscs or amphipols for maintaining native-like environment

    • Implement gentle purification protocols minimizing time outside membrane environment

Studies on fumarate reductase suggest that once the binding capacity of the membrane is saturated, further synthesis leads to accumulation of cytoplasmic forms . Therefore, strategies that enhance membrane capacity or promote efficient integration should be prioritized over simply increasing expression levels.

How might structural studies of frdC inform development of antimicrobial targets?

Structural studies of frdC hold significant potential for antimicrobial development, particularly against pathogens that rely on fumarate reductase for anaerobic survival:

  • Structure-based drug design opportunities:

    • The quinone binding sites in frdC represent attractive drug targets due to their essential role in electron transfer

    • Membrane-spanning regions unique to bacterial frdC compared to mammalian homologs offer selectivity potential

    • Interfaces between frdC and other subunits present opportunities for disrupting complex assembly

  • Research priorities:

    • High-resolution structural determination of frdC from pathogenic species, particularly Mycobacterium tuberculosis

    • Comparative analysis of frdC structures across different bacterial species to identify conserved targeting opportunities

    • Fragment-based screening against identified binding pockets

  • Metabolic vulnerability exploitation:

    • Target frdC to disrupt anaerobic metabolism in Mycobacterium tuberculosis and other pathogens that rely on fumarate reductase for survival in oxygen-limited environments

    • Develop compounds that selectively inhibit bacterial fumarate reductase without affecting mammalian succinate dehydrogenase

Fumarate reductase is thought to be particularly important in generating succinate for maintaining membrane potential in oxygen-limiting, non-replicative Mycobacteria , suggesting that frdC-targeted inhibitors could be effective against dormant tuberculosis infections that are difficult to treat with conventional antibiotics.

What are the emerging techniques for studying electron transfer dynamics in frdC?

Cutting-edge techniques are revolutionizing our understanding of electron transfer dynamics in membrane proteins like frdC:

  • Time-resolved spectroscopic methods:

    • Ultrafast transient absorption spectroscopy to capture electron movement in real-time

    • Temperature-jump techniques coupled with spectroscopic readouts

    • Multi-dimensional coherent spectroscopy to map energy landscapes

  • Advanced EPR applications:

    • Pulsed EPR methods to study the local environment of paramagnetic centers

    • Double electron-electron resonance (DEER) to measure distances between redox centers

    • High-field EPR for improved resolution of overlapping signals

  • Single-molecule approaches:

    • Single-molecule FRET to monitor conformational changes during electron transfer

    • Electrochemical scanning tunneling microscopy of reconstituted proteins

    • Nanopore-based electrical measurements of individual protein complexes

  • Computational methods:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of electron tunneling pathways

    • Machine learning approaches to predict electron transfer rates from protein structure

    • Molecular dynamics simulations of quinone binding and movement within frdC

These techniques could help resolve current contradictions in understanding the electron transfer pathway, particularly the role of heme b as either a direct participant or an electron sink in the electron transfer process .

How can systems biology approaches integrate frdC function into broader metabolic networks?

Systems biology approaches offer powerful frameworks for understanding frdC's role within cellular metabolism:

  • Genome-scale metabolic modeling:

    • Incorporate kinetic parameters of fumarate reductase into constraint-based models

    • Perform flux balance analysis to predict the impact of frdC alterations on metabolic fluxes

    • Simulate environmental shifts between aerobic and anaerobic conditions to understand regulatory transitions

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models

    • Analyze coexpression networks to identify genes consistently regulated with frdC

    • Apply contradiction analysis frameworks to resolve inconsistencies between different data types

  • Evolutionary systems biology:

    • Compare frdC variants across species to understand adaptive mutations

    • Analyze gene neighborhood conservation to identify functional partners

    • Reconstruct the evolutionary history of fumarate reductase/succinate dehydrogenase differentiation

  • Experimental system design:

    • Develop synthetic biology circuits to precisely control frdC expression

    • Create reporter systems that respond to changes in electron transport chain activity

    • Implement optogenetic control of fumarate reductase components to enable temporal studies

The FRDC's R&D Plan emphasizes systems thinking and design-thinking to ensure that the right problems are solved in the right way . This philosophical approach could be valuable for researchers seeking to understand frdC within its broader metabolic and physiological context, moving beyond reductionist approaches to embrace the complexity of biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.