Recombinant Fusarium oxysporum Chitin synthase export chaperone (chs7)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Chs7 is a 334-amino acid protein (UniProt ID: Q5YCW8) fused with an N-terminal His tag for purification. It is expressed in Escherichia coli systems and optimized for stability in Tris-based buffers with glycerol .

Table 1: Key Molecular Properties

PropertyDetails
Source OrganismFusarium oxysporum f. sp. lycopersici (strain 4287)
Expression SystemE. coli
Molecular Weight~37 kDa (predicted)
TagHis tag (N-terminal)
Purity>85% (SDS-PAGE)
Storage-20°C to -80°C in 50% glycerol; avoid repeated freeze-thaw cycles

Functional Role in Fungal Biology

Chs7 acts as an endoplasmic reticulum (ER) chaperone required for the export of class IV chitin synthases (e.g., Chs3) to the cell membrane. This process is essential for:

  • Cell Wall Integrity: Proper chitin deposition maintains hyphal structure and septation .

  • Nuclear Distribution: Δchs1 mutants exhibit abnormal nuclear clustering (up to four nuclei per compartment), unlike Δchs7 mutants, which retain wild-type-like nuclear segregation .

  • Pathogenicity: Δchs7 mutants show reduced virulence in tomato plants, highlighting its role in fungal infectivity .

Key Research Findings

Table 2: Phenotypic Effects of Chs7 Disruption

TraitWild-Type F. oxysporumΔchs7 Mutant
Hyphal HydrophobicityLowIncreased in sorbitol medium
Septation PatternRegularSimilar to wild-type
Virulence on Tomato PlantsHighReduced
Stress ToleranceNormalUnaffected (unlike Δchs2 mutants)

Transcriptional analysis reveals chs7 is expressed at intermediate levels during hyphal growth and conidiation, suggesting roles beyond vegetative development .

Applications in Research

  • Pathogenicity Studies: Used to dissect mechanisms of fungal virulence and host interactions .

  • Cell Wall Dynamics: Serves as a tool to study chitin synthase trafficking and cell wall remodeling .

  • Antifungal Target Exploration: Identified as a potential target for disrupting fungal structural integrity .

Future Directions

Recent structural studies on F. oxysporum effectors underscore the potential for integrating Chs7 into broader investigations of fungal effector evolution and host adaptation mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
chs7; FOXG_10314; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato)
Target Names
chs7
Target Protein Sequence
MSGFGDFTSICETAPLPLCASVGPTLQATGRTGIEPECYARNIELANTIIFEGAASVMHI VALIMTVIMILHVRSKFTAVGRKEILSFFYLYMLLTAMSLIIDAGVAPPGSDPYPYFVSV QNGLSSAVITCLLINGFVGFQLYEDGTPLSVWMMRISSLAAFAISFLVSLATFKSWAGLG PTNTVGLFVVLYLLNAVQLFVYVAMQILLVTRTLQDRWPLGDIAFGIFFFVAGQVLLYAF SSKICIAISHYLDGLFLATVCNLLGVMMVYKYWDSITKEDLEFSVGTRMNNWEVKELLPE EDRRATVFSEDPYAQSSSYDLPYSPGVARYSAKY
Uniprot No.

Target Background

Function
This protein acts as a chaperone, essential for the export of the chitin synthase chs3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of chitin synthase export chaperone (Chs7) in Fusarium oxysporum?

Chs7 in F. oxysporum functions as a chaperone-like protein localized to the endoplasmic reticulum (ER) that facilitates the export of chitin synthases from the ER. It was identified through comparative analysis with Saccharomyces cerevisiae Chs7p, which is required for the export of class IV chitin synthase (ScChs3p) from the ER . The disruption of chs7 in F. oxysporum results in reduced virulence during tomato plant infection, indicating its importance in pathogenicity . This chaperone likely ensures proper localization and function of chitin synthases, which are essential for synthesizing chitin, a critical component of the fungal cell wall.

How does Chs7 relate to the chitin synthase gene family in F. oxysporum?

F. oxysporum contains three identified structural chitin synthase genes (chs1, chs2, and chs3), encoding chitin synthases of classes I, II, and III, respectively . While no class IV chitin synthase gene has been directly isolated from F. oxysporum, the presence of chs7 strongly suggests that this fungus contains such enzymes, as Chs7 is specifically required for the export of class IV chitin synthases in S. cerevisiae . This is further supported by genomic data from the closely related species Fusarium graminearum, which contains multiple class IV chitin synthase genes . Interestingly, no compensatory mechanism appears to exist between these chitin synthase genes, as disruption studies showed no differences in expression levels of chs genes between disruption mutants and wild-type strains .

What methods are used to generate and confirm Chs7-deficient mutants in F. oxysporum?

Creating Chs7-deficient (Δchs7) mutants in F. oxysporum involves targeted gene disruption through homologous recombination . This methodological approach includes:

  • Construction of a disruption cassette containing a selectable marker flanked by DNA sequences homologous to regions upstream and downstream of the chs7 gene

  • Transformation of F. oxysporum protoplasts with this construct

  • Selection of transformants on appropriate antibiotic-containing media

  • Confirmation of gene disruption through multiple techniques:

    • PCR analysis to verify insertion of the disruption cassette

    • Southern blotting to confirm single integration at the correct locus

    • RT-PCR to verify the absence of chs7 transcript, as shown in Figure 4 of the studies

These Δchs7 mutants serve as valuable tools for investigating the role of Chs7 in fungal development, cell wall integrity, and pathogenicity .

What phenotypic changes are observed in F. oxysporum Δchs7 mutants?

F. oxysporum Δchs7 mutants exhibit several distinctive phenotypic changes compared to wild-type strains:

  • Reduced virulence: Pathogenicity assays on tomato plants demonstrated that Δchs7 null mutants have significantly reduced virulence

  • Increased hyphal hydrophobicity: When grown in sorbitol-containing medium, Δchs7 mutants displayed increased hyphal hydrophobicity compared to wild-type strains

  • Normal septation and nuclear distribution: Unlike some other chitin synthase mutants (particularly Δchs1, which showed compartments containing up to four nuclei), Δchs7 mutants maintained normal septation and nuclear distribution patterns similar to wild-type strains, as visualized by fluorescence microscopy using Calcofluor white and DAPI staining

  • Minor changes in chitin content: Total chitin content in Δchs7 mutants was not significantly reduced compared to wild-type strains, suggesting that Chs7 might primarily affect the localization or function of specific chitin synthases rather than total chitin synthesis

These phenotypic changes provide insights into Chs7's specific role in F. oxysporum biology and pathogenicity.

What mechanisms underlie the reduced virulence observed in F. oxysporum Δchs7 mutants?

The reduced virulence of F. oxysporum Δchs7 mutants likely stems from multiple interconnected mechanisms:

  • Altered cell wall composition and integrity: Disruption of proper chitin synthase export likely modifies cell wall architecture, potentially making the fungus more susceptible to host defense mechanisms, even though total chitin content shows only minor changes

  • Impaired stress adaptation: Δchs7 mutants exhibit increased hyphal hydrophobicity under osmotic stress conditions (sorbitol-containing medium) , suggesting compromised ability to adapt to environmental stresses encountered during host infection

  • Modified host-pathogen interface: F. oxysporum is a vascular wilt pathogen that must colonize plant xylem vessels . Cell wall alterations in Δchs7 mutants may affect the fungus's ability to withstand plant defense responses or properly interact with host tissues

  • Potential effects on secondary metabolism: F. oxysporum produces diverse secondary metabolites including alkaloids, jasmonates, anthranilates, cyclic peptides, and terpenoids with various activities . If Chs7 disruption broadly affects cellular processes, it might indirectly impact the production of these potential virulence factors

Investigating these mechanisms requires comparative transcriptomic and proteomic analyses of wild-type and Δchs7 mutants during infection, detailed microscopy of host colonization patterns, and analysis of plant defense responses.

How does disruption of chs7 affect cell wall integrity and stress responses in F. oxysporum?

The disruption of chs7 in F. oxysporum impacts cell wall integrity and stress responses through several mechanisms:

  • Cell wall architecture: While total chitin content shows only minor changes in Δchs7 mutants, the proper localization of specific chitin synthases is likely compromised, leading to subtle but significant alterations in cell wall architecture that aren't reflected in gross chitin measurements

  • Stress response pathways: Δchs7 mutants show increased hyphal hydrophobicity in sorbitol-containing medium , indicating altered responses to osmotic stress and suggesting Chs7 plays a role in cellular adaptation to environmental challenges

  • Cell wall-associated phenotypes: Compared to other chitin synthase mutants (e.g., Δchs1, which shows abnormal nuclear distribution with up to four nuclei per compartment), Δchs7 mutants maintain normal septation and nuclear distribution , indicating that the cell wall defects are specific and don't generally affect hyphal morphogenesis

A comprehensive experimental approach to characterizing these effects would include:

Test CategorySpecific AssaysExpected Outcomes in Δchs7 Mutants
Cell Wall StressCalcofluor White, Congo Red, SDS exposurePotential hypersensitivity compared to wild-type
Osmotic StressGrowth on media with NaCl, KCl, sorbitolAltered growth patterns, increased hydrophobicity
Oxidative StressH₂O₂, menadione exposurePossible increased sensitivity due to compromised cellular integrity
Temperature StressGrowth at elevated temperaturesPotential growth defects at higher temperatures
Cell Wall AnalysisTEM ultrastructure, AFM surface analysisSubtle changes in wall architecture and surface properties

What are the molecular interactions between Chs7 and chitin synthases in F. oxysporum?

The molecular interactions between Chs7 and chitin synthases in F. oxysporum are likely complex and involve multiple mechanisms:

  • Direct protein-protein interactions: By analogy with S. cerevisiae, where Chs7p interacts directly with the class IV enzyme ScChs3p, F. oxysporum Chs7 likely binds directly to specific chitin synthases in the ER

  • Quality control functions: As a chaperone-like protein, Chs7 may facilitate proper folding of chitin synthases, prevent protein aggregation, and ensure only correctly folded enzymes are exported from the ER

  • Transport facilitation: Chs7 likely assists in packaging chitin synthases into transport vesicles for export from the ER to the Golgi apparatus and ultimately to the plasma membrane or cell wall synthesis sites

  • Specificity determinants: The specificity of Chs7 for particular chitin synthases (likely class IV) suggests the existence of recognition domains or motifs that determine this selectivity

While the search results don't provide direct experimental evidence for these interactions in F. oxysporum, the functional conservation across fungal species and the phenotypic effects of chs7 disruption strongly support these proposed mechanisms . Methodological approaches to investigate these interactions would include co-immunoprecipitation, yeast two-hybrid assays, bimolecular fluorescence complementation, and structural studies.

How do environmental and developmental conditions affect chs7 expression in F. oxysporum?

The expression patterns of chs7 in F. oxysporum have been examined under specific growth conditions. Figure 4 in the research shows RT-PCR detection of chs gene transcripts in wild-type and mutant strains grown in standard medium (SM) or SM with 1.2 M sorbitol .

The expression of chs7 likely varies dynamically in response to different environmental cues and developmental stages due to changing requirements for cell wall remodeling. A comprehensive analysis would investigate:

  • Growth phases: Expression patterns during spore germination, hyphal growth, and sporulation

  • Stress conditions: Transcriptional responses to cell wall stressors, oxidative agents, pH changes, and nutrient limitation

  • Infection stages: Expression changes during host colonization, from initial penetration to systemic spread

  • Regulatory influences: Identification of transcription factors and signaling pathways controlling chs7 expression

An experimental design to characterize these expression patterns might include:

ConditionMethodologyKey Parameters
Growth PhasesqRT-PCR, RNA-seqTime-course during germination, hyphal growth, and sporulation
Stress ResponsesReporter constructs, qRT-PCRExpression after exposure to cell wall stressors, osmotic agents, oxidative agents
Infection ProcessIn planta expression analysisTime-course during tomato root infection
Regulatory AnalysisChIP-seq, promoter analysisIdentification of regulatory elements and binding transcription factors

How can structural biology approaches advance our understanding of Chs7 function?

Structural biology approaches could significantly enhance our understanding of F. oxysporum Chs7 function through:

  • Protein structure determination: Resolving the three-dimensional structure of Chs7 using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would reveal:

    • Membrane association domains

    • Potential interaction surfaces for chitin synthases

    • Structural homology with other chaperone proteins

    • Conformational changes associated with chaperone function

  • Structure-function analysis: Site-directed mutagenesis of key residues identified through structural studies could determine:

    • Critical regions for chitin synthase binding

    • Essential domains for ER retention and trafficking

    • Residues involved in specificity determination

  • Interaction studies: Co-crystallization or cryo-EM studies of Chs7 with its chitin synthase partners would elucidate:

    • The molecular basis of chaperone-client recognition

    • Conformational changes during the chaperoning process

    • Mechanisms of release and export from the ER

  • Comparative structural analysis: Comparing Chs7 structures across fungal species (e.g., F. oxysporum vs. S. cerevisiae) would reveal:

    • Conserved structural features essential for function

    • Species-specific adaptations

    • Evolutionary relationships between fungal Chs7 proteins

Though no structural data for F. oxysporum Chs7 is provided in the search results, these approaches would address fundamental questions about how this chaperone facilitates chitin synthase export and contributes to fungal pathogenicity.

What expression systems are optimal for producing recombinant F. oxysporum Chs7?

Producing recombinant F. oxysporum Chs7 requires careful consideration of expression systems, as this protein likely has complex folding requirements and membrane associations. An optimal approach would include:

  • Expression system selection:

    • Yeast systems (S. cerevisiae or P. pastoris): Provide appropriate eukaryotic folding machinery and post-translational modifications; particularly suitable as S. cerevisiae has a homologous Chs7p protein

    • Filamentous fungi (Aspergillus or Neurospora): May better accommodate the expression of proteins from filamentous fungi

    • Bacterial systems with specialized features: E. coli strains enhanced for membrane protein expression or eukaryotic protein folding

    • Insect cells (Sf9, Sf21): For higher yields of complex eukaryotic proteins

  • Construct design considerations:

    • Affinity tags: N- or C-terminal His, FLAG, or GST tags with protease cleavage sites

    • Fusion partners: MBP or SUMO to enhance solubility if needed

    • Codon optimization for the host organism

    • Signal sequences: Retention or modification of native signals for proper localization

  • Expression optimization:

    • Temperature: Often lower temperatures (18-25°C) improve folding of complex proteins

    • Induction protocols: Gradual induction with lower inducer concentrations

    • Additives: Consider stabilizing agents specific to membrane proteins

    • Time optimization: Balance between yield and protein quality

While the search results don't provide specific protocols for Chs7 expression, these approaches align with best practices for expressing fungal membrane-associated proteins.

What techniques provide the most accurate assessment of chitin content in F. oxysporum mutants?

Based on the research, chitin content in F. oxysporum was measured by determining the amount of N-acetylglucosamine (GlcNAc) after enzymatic digestion of the cell wall with chitinase and glusulase . A comprehensive approach to chitin quantification would include multiple complementary methods:

  • Enzymatic hydrolysis and GlcNAc quantification:

    • Cell wall material is digested with chitinase and glusulase enzymes

    • Released GlcNAc is quantified using colorimetric assays or HPLC

    • This method provided data showing a 10% reduction in chitin content in Δchs1 and Δchs2 mutants compared to wild-type strain 4287

  • Fluorescent labeling and microscopy:

    • Calcofluor White staining (as used in the studies for visualization)

    • Quantitative image analysis of fluorescence intensity

    • This approach allows assessment of chitin distribution in addition to relative quantification

  • Biochemical fractionation:

    • Isolation of purified cell walls through mechanical disruption

    • Alkali and acid extraction steps to isolate chitin fraction

    • Gravimetric or colorimetric quantification of isolated chitin

  • Analytical methods:

    • FTIR spectroscopy for non-destructive analysis of cell wall composition

    • Solid-state NMR for detailed structural analysis

    • Mass spectrometry for precise quantification and structural characterization

MethodAdvantagesLimitationsApplication in F. oxysporum Research
Enzymatic HydrolysisDirect quantification of GlcNAcMay not be complete for all chitin formsUsed in the cited studies to quantify chitin content
Calcofluor WhiteVisualizes distribution; simpleSemi-quantitative; binds other polysaccharidesUsed for visualization of septa and cell walls
Biochemical IsolationHigh purity of chitin fractionLabor intensive; risk of loss during extractionComplementary to enzymatic approaches
Spectroscopic MethodsNon-destructive; structural informationMay require specialized equipmentAdvanced characterization of cell wall alterations

What experimental design provides the most robust assessment of Chs7's role in F. oxysporum pathogenicity?

Based on the search results, researchers assessed F. oxysporum pathogenicity using root infection assays with tomato plants . A comprehensive experimental design for robustly assessing Chs7's role in pathogenicity would include:

  • Genetic approaches:

    • Gene disruption (Δchs7) as performed in the studies

    • Complementation with wild-type chs7 to confirm phenotype reversal

    • Site-directed mutagenesis of key domains to identify critical functional regions

    • Conditional expression systems to control chs7 expression during specific infection stages

  • Host infection assays:

    • Multiple plant hosts to assess host-specificity effects (tomato as primary model)

    • Various inoculation methods (root dip, soil infestation, stem injection)

    • Standardized disease scoring system (e.g., 0-5 scale based on wilting symptoms)

    • Time-course experiments monitoring disease progression over 2-3 weeks

  • Microscopic analysis:

    • Fluorescently tagged strains (GFP, RFP) to visualize fungal colonization in planta

    • Confocal microscopy to track vascular colonization patterns

    • Transmission electron microscopy to observe fungal cell wall ultrastructure during infection

    • Live-cell imaging to capture dynamic host-pathogen interactions

  • Statistical design considerations:

    • Randomized complete block design to account for environmental variation

    • Minimum of 10-15 plants per treatment group

    • At least three independent biological replicates

    • Appropriate statistical analysis (ANOVA with post-hoc tests, survival analysis)

The combined approach would provide robust evidence for Chs7's specific contributions to pathogenicity, distinguishing its effects from general growth or stress response defects.

What advanced microscopy techniques are most effective for studying Chs7 localization and trafficking?

To effectively study Chs7 localization and trafficking in F. oxysporum, researchers should employ several advanced microscopy techniques:

  • Fluorescent protein tagging approaches:

    • C- or N-terminal fusion of Chs7 with fluorescent proteins (GFP, mCherry)

    • Co-expression with organelle markers (ER, Golgi, vesicles) using different fluorophores

    • Functionality verification through complementation of Δchs7 phenotypes

  • Super-resolution microscopy:

    • Structured Illumination Microscopy (SIM) to achieve ~100 nm resolution

    • Stimulated Emission Depletion (STED) microscopy for ~30-50 nm resolution

    • Single-molecule localization methods (PALM/STORM) for nanoscale precision

    • These techniques can resolve subcellular details beyond the diffraction limit of conventional microscopy

  • Live-cell imaging approaches:

    • Spinning disk confocal microscopy for rapid acquisition with reduced photobleaching

    • Light sheet microscopy for long-term imaging with minimal phototoxicity

    • High-speed imaging to capture vesicular trafficking events

  • Advanced fluorescence techniques:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure Chs7 mobility

    • Förster Resonance Energy Transfer (FRET) to detect Chs7-chitin synthase interactions

    • Fluorescence Correlation Spectroscopy (FCS) for quantitative dynamics analysis

The search results indicate that basic fluorescence microscopy with Calcofluor white and DAPI staining was used to observe F. oxysporum mutants , but these advanced techniques would provide much deeper insights into Chs7 localization and dynamics.

How can transcriptomic approaches elucidate the regulatory network involving chs7?

Transcriptomic approaches offer powerful tools for understanding the regulatory network involving chs7 in F. oxysporum. Based on the RT-PCR analysis mentioned in the search results , a comprehensive transcriptomic strategy would include:

  • Global expression profiling:

    • RNA-Seq comparing wild-type and Δchs7 mutants across multiple conditions:

      • Different growth stages (germination, hyphal growth, sporulation)

      • Various stresses (cell wall, osmotic, oxidative stresses)

      • Infection time course (early, intermediate, late infection stages)

    • Microarray analysis as a complementary approach

    • qRT-PCR validation of key differentially expressed genes

  • Network analysis approaches:

    • Co-expression network construction to identify genes with similar expression patterns to chs7

    • Gene Ontology enrichment analysis of differentially expressed genes

    • Pathway analysis to identify biological processes affected by chs7 disruption

    • Promoter analysis of co-regulated genes to identify shared regulatory elements

  • Transcription factor studies:

    • ChIP-Seq to identify transcription factors binding to the chs7 promoter

    • Transcription factor overexpression/knockout studies to validate regulatory relationships

    • Reporter gene assays to confirm direct regulation

  • Integration with other data types:

    • Proteomics data to correlate transcript and protein levels

    • Metabolomics to link transcriptional changes to phenotypic outcomes

    • Comparative analysis with regulatory networks in related fungal species

Analysis TypeKey Questions AddressedExpected Outcomes
Differential ExpressionWhat genes are up/down-regulated in Δchs7 mutants?Lists of affected genes, potentially involved in cell wall synthesis, stress response, and virulence
Co-expression NetworksWhat genes show similar expression patterns to chs7?Identification of genes functionally related to chs7 and potential regulatory connections
ChIP-SeqWhat transcription factors directly regulate chs7?Identification of upstream regulators controlling chs7 expression
Comparative AnalysisHow conserved is the chs7 regulatory network across fungal pathogens?Evolutionary insights into cell wall regulation and pathogenicity mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.