Recombinant Fusobacterium nucleatum subsp. nucleatum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Production and Applications of Recombinant Fn-MscL

  • Expression systems: Likely produced in E. coli or Lactobacillus vectors, given precedents for recombinant F. nucleatum proteins (e.g., FomA) .

  • Functional assays: Expected applications include patch-clamp electrophysiology to characterize conductance and tension sensitivity, similar to E. coli MscL .

Comparative Analysis of MscL Homologs

FeatureE. coli MscL M. tuberculosis MscL Fn-MscL (Inferred)
Oligomeric stateHomopentamerHomopentamerLikely homopentamer
Transmembrane helices2 (M1, M2)2 (M1, M2)2 (M1, M2)
Pore diameter (open)~30 Å~30 Å~30 Å
Critical residuesHydrophobic seal (Ile, Leu)Hydrophobic seal (Ile, Leu)Conserved hydrophobic

Research Gaps and Future Directions

Despite its commercial availability, rFn-MscL lacks detailed characterization in published studies. Critical unknowns include:

  • Pathogenic role: F. nucleatum’s outer membrane adaptations (e.g., biofilm formation, immune evasion) suggest MscL could modulate virulence under osmotic stress.

  • Therapeutic potential: MscL channels are drug targets for antimicrobials; rFn-MscL could enable targeted inhibition studies .

  • Structural biology: Cryo-EM or crystallography of rFn-MscL would clarify divergence from homologs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; FN0766; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
mscL
Target Protein Sequence
MVLGGLMKLFDEFKAFVMRGNVVDLAVGVIIGAAFGKIVTSLVNDIFMPIIGMIIGNIDF SSLVIKLGEPVEGAEQAAIRYGMFIQEIVNFLIIALCVFVAIKLINKLQKKKEEASAPAP GPTKEEVLLTEIRDALNKIAEK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links

KEGG: fnu:FN0766

STRING: 190304.FN0766

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fusobacterium nucleatum and why is its mscL channel of research interest?

Fusobacterium nucleatum is an anaerobic gram-negative bacterium commonly found in the oral cavity and gastrointestinal tract. It has been implicated in various pathological conditions including periodontitis, inflammatory bowel disease (IBD), and colorectal carcinoma . The large-conductance mechanosensitive channel (mscL) in F. nucleatum is important for bacterial adaptation to osmotic changes in host environments. Research on mscL is valuable because:

  • It contributes to understanding bacterial survival mechanisms in different host microenvironments

  • It may reveal potential targets for antimicrobial therapies

  • It provides insights into bacterial response to mechanical stress during host colonization

How does the structure of F. nucleatum mscL compare to other bacterial mechanosensitive channels?

While the provided search results don't detail the specific structure of F. nucleatum mscL, mechanosensitive channels generally consist of transmembrane domains that respond to membrane tension. For researchers investigating F. nucleatum mscL:

  • Comparative structural analysis should be conducted against well-characterized mscL channels from model organisms

  • Sequence alignment and homology modeling approaches would be valuable starting points

  • Specific attention should be paid to conserved functional domains that may be involved in channel gating mechanisms

What role does the mscL channel play in F. nucleatum pathogenicity?

Mechanosensitive channels like mscL help bacteria adapt to changing osmotic conditions in host environments. While the direct link between mscL and F. nucleatum pathogenicity isn't explicitly stated in the search results, F. nucleatum itself has been shown to:

  • Inhibit cell proliferation in a dose-dependent manner

  • Promote cell migration and the release of chemokines/cytokines including CCL2, CXCL1, and IL-6

  • Contribute to inflammatory conditions such as IBD

  • Show correlation with colorectal carcinoma development

The mscL channel likely contributes to F. nucleatum's ability to survive in these different host environments, indirectly supporting its pathogenic potential.

What are the optimal expression systems for producing recombinant F. nucleatum mscL protein?

Based on approaches used for similar bacterial proteins, researchers should consider:

  • Prokaryotic expression systems like E. coli BL21(DE3) for initial expression trials

  • Membrane protein-optimized strains containing mutations in proteases or altered membrane compositions

  • Expression vectors with fusion tags (His, GST, MBP) to aid in purification and stability

  • Induction conditions optimization (temperature, IPTG concentration, duration)

For successful expression of membrane proteins like mscL, lower induction temperatures (16-25°C) and mild induction conditions often yield better results than standard protocols.

How can researchers effectively address the challenges of membrane protein solubilization when working with F. nucleatum mscL?

Membrane protein solubilization requires careful optimization:

  • Detergent screening should include:

    • Mild detergents (DDM, LMNG, DMNG)

    • Harsher detergents (SDS, Triton X-100) for initial extraction

    • Novel amphipols or nanodiscs for downstream applications

  • Buffer optimization should consider:

    • pH ranges compatible with F. nucleatum physiological conditions

    • Salt concentrations that maintain protein stability

    • Addition of glycerol (5-10%) to enhance stability

  • Purification strategy:

    • Two-step purification processes (affinity chromatography followed by size exclusion)

    • On-column detergent exchange during purification

What are the current hypotheses about how F. nucleatum mscL contributes to bacterial survival during host-pathogen interactions?

Current research on F. nucleatum pathogenicity suggests several potential roles for mscL:

  • Protection against osmotic stress during transition between oral and intestinal environments

  • Contribution to bacterial adaptation in inflammatory microenvironments, where F. nucleatum has been shown to impact cytokine production

  • Potential involvement in bacterial response to mechanical forces during biofilm formation or host cell invasion

Research approaches should include gene knockout studies and heterologous expression systems to test these hypotheses directly.

What are the most effective protocols for cloning and expressing the F. nucleatum mscL gene?

Based on successful approaches with other bacterial membrane proteins and information from the search results:

  • Gene synthesis and cloning:

    • Codon optimization for the expression host is recommended

    • Restriction sites (such as HindIII and XbaI, as used in the FomA protein studies ) should be incorporated for versatile cloning

    • Consider using Gateway or Gibson Assembly for seamless cloning

  • Expression vector selection:

    • Vectors with tightly controlled inducible promoters (T7, pBAD)

    • Inclusion of fusion partners (MBP, SUMO) that enhance membrane protein folding

    • C-terminal His-tags are often preferred for membrane proteins to ensure only fully translated proteins are purified

  • Transformation and expression verification:

    • Electroporation has been successfully used for introducing plasmids into bacteria, as demonstrated with Lactobacillus plantarum

    • Expression verification using Western blotting with antibodies against the fusion tag

    • Membrane fraction isolation to confirm proper localization

How can researchers assess the functional activity of recombinant F. nucleatum mscL?

Functional characterization of mscL channels requires specialized approaches:

  • Electrophysiological methods:

    • Patch-clamp analysis of reconstituted channels in liposomes

    • Planar lipid bilayer recordings to measure single-channel conductance

  • Osmotic shock assays:

    • Downshock survival assays comparing wild-type and mscL-deficient strains

    • Complementation studies with recombinant mscL to verify functional rescue

  • Fluorescence-based methods:

    • Calcein release assays from liposomes containing reconstituted mscL

    • Membrane potential-sensitive dyes to monitor channel activity in whole cells

What co-culture models best simulate the native environment for studying F. nucleatum mscL function?

Based on the research contexts where F. nucleatum has been studied:

  • Oral epithelial cell co-culture:

    • Primary gingival epithelial cells or established cell lines (e.g., HOK-16B)

    • Gingiva-derived mesenchymal stem cells (GMSCs) as used in previous studies

  • Intestinal epithelial cell models:

    • Caco-2 or HT-29 cell monolayers for intestinal barrier studies

    • Three-dimensional organoid cultures derived from intestinal stem cells

  • Co-culture conditions:

    • Defined multiplicities of infection (MOIs; F. nucleatum:cell ratios of 10:1, 50:1, and 100:1) as used in previous studies

    • Anaerobic conditions that support F. nucleatum growth while maintaining host cell viability

    • Time-course studies (24h to 4 weeks) to evaluate persistent exposure effects

How should researchers approach RNA-sequencing data analysis when investigating F. nucleatum mscL expression?

RNA-sequencing analysis for F. nucleatum mscL studies should follow these methodological steps:

  • Experimental design considerations:

    • Time-dependent activation of cellular signaling pathways should be monitored (3, 7, 14, and 21 days post-infection as used in previous studies)

    • Include appropriate controls (non-infected vs. infected conditions)

  • Data analysis pipeline:

    • Quality control and trimming of raw reads

    • Alignment to F. nucleatum reference genome

    • Differential expression analysis using tools like DESeq2 or edgeR

    • Pathway enrichment analysis focusing on membrane protein processing and stress response pathways

  • Validation approaches:

    • qPCR confirmation of mscL and related genes' expression changes

    • Protein-level validation through Western blotting or proteomics

Previous F. nucleatum studies have successfully identified differentially expressed genes (DEGs) between non-infected and infected conditions, with some genes showing enrichment in cancer-related pathways .

What are the best statistical approaches for analyzing differences in mscL function between F. nucleatum strains?

For robust statistical analysis:

  • Study design requirements:

    • Minimum of 3-6 biological replicates per condition

    • Technical replicates to account for methodological variation

  • Statistical methods:

    • One-way ANOVA with Tukey's multiple-comparison test for parametric data

    • Non-parametric analysis with Kruskal-Wallis test for non-normally distributed data

    • These approaches have been successfully applied in F. nucleatum research

  • Data presentation standards:

    • Results should be presented as mean ± standard deviation

    • Significance levels should be clearly indicated (* P < 0.05; ** P < 0.01; and *** P < 0.001)

    • Appropriate visualization through box plots or violin plots for distribution data

How can researchers reconcile contradictory findings about F. nucleatum mscL function across different experimental models?

To address contradictory findings:

  • Systematic comparison of experimental conditions:

    • Create a comprehensive table documenting key variables across studies

    • Analyze whether differences in bacterial strains, growth conditions, or host cell types explain contradictory results

  • Meta-analysis approaches:

    • When sufficient quantitative data is available, perform formal meta-analysis

    • Calculate effect sizes to determine the magnitude and direction of experimental interventions

  • Validation strategies:

    • Replicate key experiments using standardized protocols

    • Employ multiple complementary techniques to measure the same parameter

    • Use genetic approaches (gene knockout, complementation) to verify specific protein functions

What are the most effective methods for detecting F. nucleatum and its mscL expression in clinical samples?

Based on approaches used in F. nucleatum research:

  • DNA-based detection methods:

    • Quantitative PCR (qPCR) has been used for detecting F. nucleatum in colorectal carcinoma, adjacent normal tissue, and control tissue

    • Sequencing of qPCR products to confirm specificity

    • Digital droplet PCR for enhanced sensitivity in low-abundance samples

  • RNA-based methods:

    • RT-qPCR for mscL transcript quantification

    • RNA-FISH for spatial localization in tissue samples

    • RNA-seq for comprehensive transcriptomic profiling

  • Protein-based detection:

    • Immunohistochemistry using antibodies against mscL or other F. nucleatum markers

    • Western blotting of tissue lysates

    • Mass spectrometry-based proteomics for unbiased detection

The search results indicate variable detection rates for F. nucleatum in clinical samples (25% of colorectal carcinomas, 15% of adjacent normal tissue) , highlighting the technical challenges in consistent detection.

How can researchers overcome the challenges of poor expression or misfolding of recombinant F. nucleatum mscL?

To address expression and folding challenges:

  • Expression optimization strategies:

    • Screen multiple expression hosts beyond E. coli (Lactobacillus, yeast systems)

    • Test different fusion partners known to enhance membrane protein folding

    • Employ specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

  • Folding enhancement approaches:

    • Reduce expression temperature to 16-20°C and extend induction time

    • Add chemical chaperones to growth media (glycerol, betaine, sorbitol)

    • Co-express molecular chaperones that assist membrane protein folding

  • Alternative production strategies:

    • Cell-free protein synthesis systems optimized for membrane proteins

    • Insertion of stabilizing mutations based on computational predictions

    • Truncation constructs focusing on core functional domains

What are the current limitations in understanding the structure-function relationship of F. nucleatum mscL?

Current limitations and approaches to address them include:

  • Structural characterization challenges:

    • Limited high-resolution structural data for F. nucleatum proteins

    • Challenges in obtaining sufficient quantities of purified, functional protein

    • Membrane protein crystallization difficulties

  • Approaches to overcome these limitations:

    • Cryo-electron microscopy as an alternative to crystallography

    • Molecular dynamics simulations based on homology models

    • Site-directed mutagenesis of predicted functional residues followed by functional assays

  • Integration of structural and functional data:

    • Electrophysiological measurements correlated with structural predictions

    • Accessibility studies using cysteine scanning mutagenesis

    • Computational models validated through experimental approaches

How might understanding F. nucleatum mscL function contribute to developing new antimicrobial strategies?

Potential therapeutic applications include:

  • Target-based drug development:

    • Small molecule inhibitors of mscL function could compromise bacterial osmotic regulation

    • Peptide-based blockers designed to interact with the channel pore

    • Compounds that lock the channel in either open or closed conformations

  • Combination therapy approaches:

    • mscL inhibitors could potentially sensitize F. nucleatum to conventional antibiotics

    • Targeting mscL along with other virulence factors like FomA

  • Vaccine development considerations:

    • Similar to the approach with FomA protein, recombinant vaccines expressing mscL epitopes could be developed

    • Lactobacillus-based delivery systems have shown promise for mucosal immunity against F. nucleatum components

What are the most promising directions for engineering F. nucleatum mscL for biotechnology applications?

Biotechnological applications could include:

  • Biosensor development:

    • Engineered mscL channels as tension-sensitive molecular switches

    • Reporter systems coupled to mscL gating for detecting membrane-active compounds

  • Controlled delivery systems:

    • Modified mscL channels in liposomes for tension-triggered release of encapsulated molecules

    • Cell-based delivery systems with engineered mechanosensitivity

  • Synthetic biology applications:

    • Integration of mscL into synthetic cellular circuits responding to mechanical stimuli

    • Development of bacterial strains with modified mechanosensing capabilities for basic research

How can multi-omics approaches advance our understanding of F. nucleatum mscL in the context of human disease?

Integrated approaches should include:

  • Combined genomics, transcriptomics, and proteomics:

    • Whole genome sequencing to identify strain-specific mscL variations

    • RNA-seq to determine expression patterns during infection or stress

    • Proteomics to confirm translation and post-translational modifications

  • Systems biology integration:

    • Pathway analysis connecting mscL function to broader cellular processes

    • Network models incorporating host-pathogen interaction data

    • Mathematical modeling of mechanosensing in bacterial physiology

  • Clinical correlation studies:

    • Analysis of mscL sequence and expression in patient-derived F. nucleatum isolates

    • Correlation of mscL variants with disease severity in conditions like IBD or colorectal cancer

    • Longitudinal studies tracking changes in F. nucleatum populations during disease progression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.