Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; FN0004; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
yidC
Target Protein Sequence
MSYIYNLLKQFLAFLLNTTDKYVGNFGISIIIVTILIKIILLPLTLKQDKSMKEMKKLQP ELEKIKQKYANDKQMLNIKTMELYREHKVNPLGGCLPILVQLPILFALFGVLRSGIIPAD SSFLWMRLADPDPFYVLPVLNGAVSFLQQKLMGTSDNAQMKNMMYVFPIMMIVISYRMPS GLQLYWLTSSLIAVIQQYFIMKKGA
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.
Database Links

KEGG: fnu:FN0004

STRING: 190304.FN0004

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of F. nucleatum YidC and how does it compare to homologs in other species?

While the specific structure of F. nucleatum YidC has not been fully characterized, structural analysis of YidC homologs suggests a distinctive arrangement where the protein creates a hydrophilic microenvironment within the lipid bilayer rather than forming a complete transmembrane channel . This structure allows YidC to function as a "proteinaceous amphiphile" that reduces the energetic cost of membrane protein insertion.

How does the genomic context of yidC in F. nucleatum inform our understanding of its function?

F. nucleatum strain ATCC 25586 has a 2.17 Mb genome with 27% GC content encoding 2,067 open reading frames on a single circular chromosome . While specific genomic context information for yidC is limited in the provided data, understanding the organization of membrane protein biogenesis genes in F. nucleatum can provide insights into specialized adaptation mechanisms.

F. nucleatum's genome reveals it has several unique features compared to other gram-negative bacteria, with some metabolic pathways resembling those of gram-positive bacteria like Clostridium, Enterococcus, and Lactococcus species . This suggests that YidC in F. nucleatum may have evolved specific adaptations to function optimally in this bacterium's unique cellular environment.

What experimental evidence confirms YidC's role in membrane protein insertion in F. nucleatum?

While direct experimental evidence for F. nucleatum YidC is limited, studies on YidC homologs in other bacteria provide a framework for understanding its likely function. In bacteria generally, YidC mediates membrane protein integration either independently as an insertase or in concert with the SecY complex .

Experimental methodologies that could be applied to F. nucleatum YidC include:

  • In vivo depletion studies to observe effects on membrane protein localization

  • Co-purification of YidC with nascent membrane proteins

  • Cryo-electron microscopy to visualize YidC-ribosome complexes during active translation

  • Site-directed mutagenesis of predicted functional residues within the hydrophilic cavity

What is the mechanism by which F. nucleatum YidC facilitates membrane protein insertion?

Based on structural studies of YidC homologs, F. nucleatum YidC likely facilitates membrane protein insertion through a distinctive mechanism involving a hydrophilic cavity rather than a transmembrane channel . The process appears to follow these steps:

  • Ribosome docking at a specific binding site on YidC near the ribosomal tunnel exit

  • Nascent membrane protein emergence into the YidC hydrophilic cavity

  • Gradual transfer of the substrate from the hydrophilic environment to the lipid bilayer via the YidC-lipid interface

  • Release of fully inserted membrane protein into the lipid environment

The cavity's hydrophilicity appears crucial for reducing the energetic barrier for polar regions of the substrate to traverse the membrane, while the hydrophobic segments can readily partition into the lipid phase .

How does one design experiments to identify YidC substrates in F. nucleatum?

Identifying YidC substrates requires careful experimental design:

Methodological Approach Table for YidC Substrate Identification:

MethodImplementationAdvantagesLimitations
Cross-linking studiesUse photoactivatable amino acids in YidC to capture transient interactions with substratesIdentifies direct interactionsMay miss weak or transient interactions
Proteomics after YidC depletionCompare membrane proteome with and without YidC expressionComprehensive screening approachMay identify indirect effects
Ribosome profilingSequence mRNAs associated with YidC-bound ribosomesIdentifies co-translational substratesLabor-intensive and technically challenging
In vitro reconstitutionTest insertion of candidate proteins with purified YidCDirect functional assessmentLimited throughput
Genetic screeningIdentify synthetic lethal interactions with yidC mutationsDiscovers functional relationshipsMay identify indirect genetic interactions

When designing these experiments, researchers should consider F. nucleatum's anaerobic growth requirements and potential differences in membrane composition compared to model organisms like E. coli .

What critical residues in the hydrophilic cavity of YidC are essential for function?

Based on studies of YidC homologs, the hydrophilic cavity contains several functionally important residues. In particular, a positively charged amino acid (typically arginine) appears to be critical for function, though its specific position can vary .

The presence of a positively charged residue on the cavity surface likely facilitates the translocation of negatively charged regions of substrate proteins. Experimental approaches to identify these critical residues include:

  • Alanine-scanning mutagenesis of conserved residues lining the cavity

  • Charge-swap experiments (e.g., Arg→Glu) to test electrostatic requirements

  • Functional complementation assays to test mutant YidC proteins

What are the optimal conditions for expressing and purifying recombinant F. nucleatum YidC?

Recommended Protocol for Recombinant F. nucleatum YidC Production:

  • Expression System Selection:

    • E. coli C43(DE3) or LEMO21(DE3) strains are recommended for membrane protein expression

    • Consider codon optimization for F. nucleatum's distinct codon usage

  • Vector Design:

    • Include a C-terminal His6 or His10 tag for purification

    • Consider using a fusion partner (e.g., GFP) to monitor expression and folding

  • Expression Conditions:

    • Induce at lower temperatures (16-20°C) to promote proper folding

    • Use mild induction conditions (0.1-0.5 mM IPTG)

    • Extended expression time (16-24 hours)

  • Membrane Extraction:

    • Use mild detergents (DDM, LMNG, or amphipols) for extraction

    • Include stabilizing agents such as glycerol (10%) and specific lipids

  • Purification Strategy:

    • IMAC purification using Ni-NTA or TALON resin

    • Size exclusion chromatography for final purity

    • Evaluate protein quality using SDS-PAGE and Western blotting

When working with F. nucleatum proteins, researchers should consider that F. nucleatum has a distinct metabolism compared to E. coli, which may affect codon usage and protein folding requirements .

How can researchers effectively study YidC-ribosome interactions in F. nucleatum?

Studying YidC-ribosome interactions requires specialized techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Prepare complexes of translating ribosomes with YidC

    • Use nascent chains of known YidC substrates

    • Process data to obtain 3D reconstructions of the complex

  • Ribosome profiling with YidC immunoprecipitation:

    • Cross-link YidC to associated ribosomes

    • Immunoprecipitate YidC and sequence associated mRNAs

    • Identify transcripts being actively translated during YidC interaction

  • Fluorescence techniques:

    • FRET pairs between labeled YidC and ribosomal proteins

    • Single-molecule fluorescence to track dynamic interactions

Models from other bacteria suggest that YidC interacts with the ribosome at the ribosomal tunnel exit, creating a protected environment for membrane protein insertion at the YidC protein-lipid interface .

What methods are available for assessing YidC-mediated membrane protein insertion efficiency?

Methodological Approaches for Measuring Insertion Efficiency:

MethodImplementationReadoutAdvantages
Protease protection assaysExpress model substrates with YidC, treat with proteaseGel analysis of protected fragmentsSimple, quantitative
Reporter fusionsFuse substrates with reporters (GFP, LacZ)Enzymatic activity or fluorescenceIn vivo assessment
In vitro translation-insertionReconstitute YidC in liposomes, add ribosomes and mRNAMembrane association of translated proteinsControlled environment
Alkylation assaysUse cysteine mutants and membrane-impermeable reagentsDetection of modified vs. protected cysteinesTopology determination
Fluorescence microscopyVisualize localization of fluorescent substrate proteinsMembrane localization patternsSingle-cell resolution

These methods can be adapted to F. nucleatum YidC by using species-specific substrates and considering the unique properties of F. nucleatum membranes.

How does F. nucleatum YidC compare structurally and functionally to homologs in other bacterial species?

While specific comparative data for F. nucleatum YidC is limited, general patterns of YidC evolution provide insights:

Comparative Features of YidC Across Bacterial Species:

FeatureF. nucleatum YidC (predicted)E. coli YidCB. subtilis SpoIIIJ
Transmembrane domainsLikely 5 conserved TMs6 TMs (TM1 not essential)5 TMs
Hydrophilic cavityPresentPresentPresent, accessible to aqueous environment
Critical residuesLikely contains Arg in cavityCharged residues in cavityArg residue at several potential positions
Ribosome interactionLikely at tunnel exitAt ribosomal tunnel exitSimilar to E. coli
Additional functionsUnknownRequired for ATP synthase assemblyMultiple functions including sporulation

Despite variation in specific features, the core mechanism of using a hydrophilic cavity to facilitate membrane protein insertion appears to be conserved across diverse bacterial species .

What can genomic and phylogenetic analyses tell us about the evolution of YidC in Fusobacteria?

Genomic and phylogenetic analyses could reveal:

  • Whether F. nucleatum contains single or multiple YidC paralogs

  • The evolutionary relationship between Fusobacterial YidC and homologs in other bacterial phyla

  • Conservation patterns of functional residues across Fusobacterial species

  • Potential co-evolution with specific substrate proteins

F. nucleatum has a relatively small genome (2.17 Mb) with 2,067 open reading frames and 27% GC content . This compact genome may influence the evolutionary constraints on YidC, potentially leading to specialized adaptations for the specific membrane proteins it must insert.

The taxonomic position of F. nucleatum among gram-negative bacteria, combined with metabolic features similar to gram-positive Clostridium, Enterococcus, and Lactococcus species , suggests that its YidC may have unique properties reflecting this evolutionary history.

How might YidC function contribute to F. nucleatum's role in diseases such as colorectal cancer?

F. nucleatum is increasingly recognized for its role in colorectal cancer (CRC), with significantly higher abundance in CRC tissues compared to normal colorectal tissue . YidC could contribute to pathogenesis through:

  • Insertion of virulence factors: YidC may be required for the proper membrane integration of adhesins, invasins, and other virulence-associated membrane proteins.

  • Adaptation to host environments: By facilitating the insertion of specialized transporters and metabolic enzymes, YidC could help F. nucleatum adapt to the tumor microenvironment.

  • Biofilm formation: Proper assembly of membrane proteins involved in adhesion and bacterial communication could influence biofilm development.

F. nucleatum appears to create metabolic changes in the gut, including suppression of butyric acid production, which may contribute to CRC progression . The proper insertion of membrane proteins involved in these metabolic interactions likely depends on YidC function.

What experimental approaches can link YidC function to specific virulence mechanisms in F. nucleatum?

Experimental Strategy Table for Studying YidC in Virulence:

ApproachMethodologyExpected OutcomesLimitations
Conditional YidC depletionInducible knockdown system in F. nucleatumIdentification of virulence defectsTechnical challenge in genetic manipulation
YidC substrate identificationProteomics comparing wild-type and YidC-depleted strainsDiscovery of virulence factors dependent on YidCMay miss low-abundance proteins
Host cell interaction assaysCompare adhesion/invasion with YidC variantsQuantification of virulence attenuationIn vitro systems may not reflect in vivo conditions
Animal infection modelsUse YidC mutants in CRC mouse modelsAssessment of tumor-promoting capabilitiesEthical considerations and translational limitations
TranscriptomicsRNA-seq during host interactionIdentify conditions where YidC and substrates are upregulatedExpression may not correlate with functional importance

Understanding YidC's role could provide new targets for disrupting F. nucleatum's pathogenic potential, especially given its association with colorectal cancer progression and its ability to alter the intestinal metabolic environment .

How can structural information about YidC be used to design inhibitors of membrane protein insertion in F. nucleatum?

The unique structure of YidC, with its hydrophilic cavity within the membrane , provides potential targets for inhibitor design:

  • Target Sites:

    • Critical residues within the hydrophilic cavity

    • Ribosome binding interface

    • Substrate recognition regions

    • Conformational change mechanisms

  • Inhibition Strategies:

    • Small molecules that occupy the hydrophilic cavity

    • Peptides that mimic YidC-substrate interactions

    • Compounds that lock YidC in non-functional conformations

  • Design Approaches:

    • Structure-based virtual screening targeting the hydrophilic cavity

    • Fragment-based drug discovery focused on critical interaction sites

    • Peptidomimetics designed to compete with natural substrates

Inhibiting YidC function could potentially disrupt F. nucleatum's ability to properly insert virulence-associated membrane proteins, potentially attenuating its role in diseases like colorectal cancer .

What are the implications of studying YidC for understanding F. nucleatum's adaptation to different host environments?

F. nucleatum must adapt to diverse environments from the oral cavity to colorectal tissue, requiring specialized membrane proteins for each niche. YidC likely plays a critical role in this adaptation:

  • Niche-specific membrane proteome:

    • YidC may insert different sets of transporters and receptors in different environments

    • Regulation of YidC activity could influence membrane composition

  • Host interaction factors:

    • Adhesins and invasins required for host cell interaction depend on proper membrane insertion

    • Immune evasion factors may require YidC for functional assembly

  • Metabolic adaptation:

    • F. nucleatum alters metabolic pathways in different environments, including suppression of butyric acid production in the gut

    • Membrane-bound metabolic enzymes likely require YidC for integration

Understanding these adaptations could provide insights into how F. nucleatum transitions between commensal and pathogenic roles in different host tissues.

How might co-translational insertion via YidC be coordinated with other cellular processes in F. nucleatum?

YidC-mediated co-translational insertion likely coordinates with multiple cellular systems:

  • Translation machinery:

    • YidC interacts with ribosomes at the tunnel exit during active translation

    • May coordinate with translation factors to regulate translation rates

  • Protein quality control:

    • Potential interaction with chaperones and proteases

    • Recognition and handling of misfolded membrane proteins

  • Cell division and growth:

    • Coordination with cell envelope expansion

    • Potential role in asymmetric protein distribution during growth

  • Stress responses:

    • Adaptation of insertion machinery during environmental challenges

    • Potential role in membrane remodeling under stress

These coordinated processes would be particularly important in F. nucleatum's adaptation to changing environments during infection and colonization of different host tissues.

What are the primary technical barriers to studying YidC function in F. nucleatum and how can they be overcome?

Several technical challenges complicate research on F. nucleatum YidC:

Technical Challenges and Potential Solutions:

ChallengeDescriptionPotential Solutions
Anaerobic growth requirementsF. nucleatum is an obligate anaerobeDevelop anaerobic workstations; use genetic systems from anaerobic organisms
Limited genetic toolsFewer established methods for genetic manipulationAdapt CRISPR-Cas9 systems for anaerobes; develop new transformation protocols
Membrane complexityUnusual membrane composition compared to model organismsDevelop F. nucleatum-specific membrane mimetics for in vitro studies
Protein stabilityMembrane proteins are inherently challenging to work withOptimize detergent and buffer conditions; use stabilizing fusion partners
Pathogen containmentBiosafety considerations for pathogen researchDevelop non-pathogenic model strains; use reconstituted systems

Advances in cryo-electron microscopy and single-particle analysis provide promising approaches for structural studies of F. nucleatum YidC without requiring large quantities of purified protein .

What emerging technologies might advance our understanding of YidC function in F. nucleatum?

Several cutting-edge technologies show promise for YidC research:

  • Cryo-electron tomography:

    • Visualize YidC in its native membrane environment

    • Observe insertion events in situ

  • Single-molecule tracking:

    • Follow YidC dynamics in living cells

    • Measure kinetics of substrate interaction and insertion

  • High-throughput mutagenesis:

    • Systematic analysis of all residues in YidC

    • Deep mutational scanning to identify functional regions

  • Artificial intelligence approaches:

    • Predict YidC-substrate interactions

    • Model conformational changes during insertion

  • Microfluidic systems:

    • Study YidC function under precisely controlled conditions

    • Rapid screening of inhibitors or functional variants

These technologies could help overcome the current limitations in studying this challenging but important membrane protein system.

How might insights from F. nucleatum YidC research translate to broader understanding of membrane protein biogenesis?

Studying YidC in F. nucleatum could provide unique insights into fundamental aspects of membrane protein biology:

  • Evolutionary adaptation:

    • Understanding how insertion machinery adapts to different membrane compositions

    • Identifying core conserved mechanisms across diverse species

  • Disease relevance:

    • Connection between membrane protein insertion and pathogenesis

    • Potential new antimicrobial targets and strategies

  • Biophysical principles:

    • Further elucidation of how hydrophilic cavities facilitate membrane traversal

    • Energy requirements for membrane protein insertion

  • Synthetic biology applications:

    • Design of artificial membrane protein insertion systems

    • Engineering membrane proteins with specific insertion requirements

The unique position of F. nucleatum—having gram-negative architecture but some metabolic similarities to gram-positive bacteria —makes its YidC system particularly interesting for comparative studies across bacterial phyla.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.