Recombinant Fusobacterium nucleatum subsp. nucleatum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Lgt in Fusobacterium nucleatum

Lipoprotein diacylglyceryl transferase (Lgt) is a key enzyme in bacterial lipid modification, catalyzing the attachment of diacylglyceryl groups to the cysteine residue of prolipoproteins. In Fusobacterium nucleatum subsp. nucleatum, Lgt is essential for the maturation of lipoproteins, which anchor to the bacterial membrane and play critical roles in pathogenesis, including immune evasion and host tissue colonization .

Biochemical Role and Mechanism

Lgt operates in the lipoprotein biosynthesis pathway, working alongside signal peptidase II (Lsp) and N-acyltransferase (Lnt) in Gram-negative bacteria. The process involves:

  1. Diacylglyceryl Transfer: Lgt transfers a diacylglyceryl group from phosphatidylglycerol to the thiol of the conserved cysteine residue in the lipobox motif (L[AS][GA]C) of prolipoproteins.

  2. Signal Peptide Cleavage: Lsp removes the signal peptide, generating mature diacylated lipoproteins .

Key Features of Lgt in F. nucleatum:

PropertyDescription
Enzyme SpecificityActs on prolipoproteins with the lipobox motif.
Lipid SourceUtilizes phosphatidylglycerol as the diacylglyceryl donor.
Functional OutputDiacylated lipoproteins critical for virulence (e.g., FAD-I, Fap2) .

Functional Implications in Pathogenesis

Lgt-modified lipoproteins drive F. nucleatum’s pathogenicity:

  1. Immune Evasion: Diacylated lipoproteins like FAD-I induce Toll-like receptor (TLR)-mediated host defensin production (e.g., hBD-2), modulating innate immunity .

  2. Tumor Progression: Lgt-dependent lipoproteins (e.g., FadA) upregulate Annexin A1 in colorectal cancer cells, promoting Wnt/β-catenin signaling and tumor growth .

  3. Biofilm Formation: Lipoproteins anchor to the membrane, facilitating bacterial adhesion to host tissues and extracellular vesicle production .

Comparative Analysis of Lgt in Bacterial Pathogens

OrganismLgt FunctionKey Lipoproteins
F. nucleatumDiacylation of virulence lipoproteinsFAD-I, Fap2, FadA
E. coliTriacylation via LntOuter membrane proteins
Borrelia spp.Acetylation of lipoproteinsOspA, OspB

Research Gaps and Future Directions

  • Recombinant Lgt Studies: No direct reports on recombinant F. nucleatum Lgt exist. Future work could explore its substrate specificity and interaction with F. nucleatum lipoproteins.

  • Therapeutic Targets: Inhibiting Lgt may disrupt lipoprotein maturation, offering novel antimicrobial strategies against F. nucleatum infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
lgt; FN0489; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
lgt
Target Protein Sequence
MNPVFLKIGPIELHYYGLMYAIAFFVGISLGKKIAKERNFDLDLVENYAFVAIISGLIGG RLYYILFNLPYYLQNPFEILAVWHGGMAIHGGILGGIAGTLIFAKIKKINPLILGDFAAG PFILGQAIGRIGNFMNGEVHGVPTFTPFSVIFNVKPKFYEWYTYYQSLSISDKANYPDLV PWGVVFPTSSPAGSEFPNLALHPAMLYELILNLIGFFIIWFILRKKENKASGYMWWWYII IYSINRIIVSFFRVEDLMFFNFRAPHVISIILIAVSIFFLKKDNKKVF
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: fnu:FN0489

STRING: 190304.FN0489

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Fusobacterium nucleatum?

Prolipoprotein diacylglyceryl transferase (lgt) is a key enzyme responsible for the first step in bacterial lipoprotein maturation. It catalyzes the S-diacylation of prolipoproteins using a diacylated glycerophospholipid (GPL) donor, transferring a diacylglyceryl moiety to the sulfhydryl group of the conserved cysteine residue in the lipobox motif of bacterial prolipoproteins . In Fusobacterium nucleatum, this process is essential for the proper functioning of numerous surface-associated lipoproteins that contribute to bacterial virulence and host interactions.

How is the lgt gene conserved across bacterial species compared to Fusobacterium nucleatum?

The lgt gene is highly conserved across diverse bacterial species, reflecting its essential role in bacterial physiology. Comparative genomic analyses reveal that while the enzyme maintains functional conservation, there are significant sequence variations:

SpeciesSequence Identity with F. nucleatum lgtSequence Similarity with F. nucleatum lgt
Staphylococcus aureus24%47%
Escherichia coli24%47%
Salmonella typhimurium24%47%
Haemophilus influenzae24%47%

These comparisons demonstrate that despite low sequence identity, functional similarity is maintained, suggesting evolutionary pressure to preserve the enzyme's critical function across phylogenetically distant bacteria .

What structural domains are essential for lgt function in Fusobacterium nucleatum?

Based on comparative analyses with other bacterial species, several highly conserved regions in lgt are critical for its function. Most notably, the H-103-GGLIG-108 motif represents the longest set of identical amino acids without any gap across multiple bacterial species. Mutation studies have demonstrated that alterations in this region, particularly at Gly-104, significantly impair enzyme activity. For example, in E. coli, a Gly-104 to Ser mutation results in temperature-sensitive growth and reduced LGT activity, suggesting this region is crucial for catalytic function in F. nucleatum as well .

How does the expression of lgt in Fusobacterium nucleatum correlate with its pathogenic potential in colorectal cancer?

Fusobacterium nucleatum is significantly enriched in colorectal cancer (CRC) tissues compared to normal colorectal tissue, with subspecies animalis (Fna) clade 2 specifically associated with CRC tumors . While direct expression data for lgt is limited, its role in lipoprotein maturation is critical for F. nucleatum virulence. Mature lipoproteins contribute to bacterial adhesion, invasion, and host immune modulation.

Research findings demonstrate:

Tissue TypeF. nucleatum Detection RateRelative Abundance
CRC Tissue25%Significantly higher
Adjacent Normal Tissue15%Lower than CRC
Matched Control Tissue0%Not detected

These data suggest that while F. nucleatum detection varies across studies, its enrichment in CRC tissues indicates a potential role for lgt-processed lipoproteins in cancer pathogenesis .

What is the relationship between lgt activity in Fusobacterium nucleatum and its ability to induce changes in the gut microbiome?

F. nucleatum colonization significantly alters the gut microbiome composition, particularly affecting butyrate-producing bacteria. When F. nucleatum is introduced to the gut, research shows:

  • Decreased abundance of butyric acid-producing bacteria (Lactobacillus, Roseburia, and Clostridium)

  • Significant reduction in short-chain fatty acids (SCFAs), particularly butyric acid levels

  • Metabolic profile alterations detectable via PLS-DA analysis

The precise role of lgt in this relationship remains an area for investigation, but properly processed lipoproteins likely facilitate F. nucleatum's colonization and persistence, enabling these microbiome alterations .

How does the lgt-mediated lipoprotein processing in Fusobacterium nucleatum contribute to its invasive capabilities in human tissues?

Lgt-processed lipoproteins are critical for F. nucleatum's invasive capabilities, particularly in contexts like colorectal cancer and trophoblast invasion. Research demonstrates that F. nucleatum at low concentrations significantly enhances HTR8/SVneo trophoblast cell invasion, accompanied by increased secretion of:

Secreted FactorsResponse to F. nucleatum
CXCL1Increased secretion
IL-6Increased secretion
IL-8Increased secretion
MMP-2Increased secretion
MMP-9Increased secretion

These effects are partially mediated through TLR4 signaling and E-cadherin interactions, with properly processed surface lipoproteins likely serving as important mediators for these interactions .

What are the optimal conditions for expressing recombinant Fusobacterium nucleatum lgt in heterologous systems?

Expressing recombinant F. nucleatum lgt requires careful optimization due to its membrane-associated nature and anaerobic origin. Based on related research approaches:

  • Expression System Selection:

    • E. coli BL21(DE3) with pET vector systems has been successful for related membrane proteins

    • Complementation of temperature-sensitive lgt mutants (similar to the approach used with S. aureus lgt) offers a functional expression system

  • Expression Conditions:

    • Induction with 0.1-0.5 mM IPTG at reduced temperatures (16-25°C)

    • Extended expression time (16-24 hours) to allow proper membrane insertion

    • Inclusion of 1% glucose to suppress basal expression

  • Extraction and Purification:

    • Membrane fraction isolation using ultracentrifugation

    • Solubilization with mild detergents (n-dodecyl-β-D-maltoside or CHAPS)

    • Purification via His-tag affinity chromatography under reducing conditions

These parameters should be optimized specifically for F. nucleatum lgt, as membrane protein expression can vary significantly between proteins and source organisms.

What assays can be used to measure the enzymatic activity of recombinant Fusobacterium nucleatum lgt?

Several complementary approaches can be employed to assess lgt enzymatic activity:

  • In vivo Complementation Assay:

    • Introduction of recombinant F. nucleatum lgt into temperature-sensitive lgt mutant strains (e.g., E. coli SK634)

    • Assessment of growth restoration at non-permissive temperatures

    • Verification of prolipoprotein modification via Western blotting

  • In vitro Biochemical Assay:

    • Preparation of radiolabeled glycerophospholipid substrates (typically [³H]-labeled)

    • Incubation with purified enzyme and prolipoprotein substrate

    • TLC or SDS-PAGE separation followed by autoradiography to detect transfer of diacylglyceryl moiety

  • Mass Spectrometry-Based Assay:

    • Incubation of recombinant enzyme with synthetic peptide substrates containing the lipobox motif

    • LC-MS/MS analysis to detect mass shift corresponding to diacylglyceryl addition

    • Quantification of substrate-to-product conversion

Each assay provides complementary information, with the in vivo approach confirming functional activity and the in vitro methods allowing detailed kinetic and mechanistic studies.

How can site-directed mutagenesis be effectively employed to study structure-function relationships in Fusobacterium nucleatum lgt?

Site-directed mutagenesis represents a powerful approach for investigating the catalytic mechanism and structural requirements of F. nucleatum lgt:

  • Target Selection Strategies:

    • Conserved residues identified through multiple sequence alignment, particularly the H-103-GGLIG-108 motif

    • Residues identified through chemical modification studies (e.g., diethylpyrocarbonate-sensitive histidine residues)

    • Predicted membrane-spanning domains and catalytic sites based on hydropathy analysis

  • Mutagenesis Protocol Optimization:

    • PCR-based methods using complementary primers containing the desired mutation

    • Gibson Assembly for larger modifications or multiple simultaneous changes

    • Verification by sequencing before functional testing

  • Functional Assessment Framework:

    • Complementation efficiency in temperature-sensitive lgt mutants

    • Enzyme kinetics alterations (Km, Vmax, kcat) using in vitro assays

    • Thermal stability changes measured by differential scanning fluorimetry

  • Data Interpretation Approach:

    • Correlation of mutational effects with structural predictions

    • Comparison with known effects in other bacterial species

    • Development of a refined catalytic mechanism model

This systematic approach allows delineation of residues involved in substrate binding, catalysis, and structural integrity of the enzyme.

How do findings about Fusobacterium nucleatum lgt relate to its broader virulence mechanisms in human disease?

Prolipoprotein diacylglyceryl transferase functions within a complex network of F. nucleatum virulence factors:

  • Relationship with Adhesins:

    • F. nucleatum possesses multiple adhesin families including FadA, autotransporters, and MORN2 domain proteins

    • Proper processing of lipoprotein adhesins by lgt likely contributes to host cell binding and invasion

    • FadA, a key adhesin, binds E-cadherin and activates β-catenin signaling, promoting inflammatory responses

  • Immunomodulatory Effects:

    • F. nucleatum has established immunosuppressive properties through proteins like FIP and Fap2

    • Lipoproteins processed by lgt may contribute to immune evasion and modulation

    • F. nucleatum-induced immune changes include altered cytokine production (IL-6, IL-8) and metalloproteinase activity

  • Disease Connections:

    • Colorectal cancer: F. nucleatum is enriched in tumor tissues and alters gut metabolite profiles

    • Pregnancy complications: Low amounts of F. nucleatum promote trophoblast invasion and cytokine secretion

    • Various inflammatory conditions linked to F. nucleatum may involve lgt-processed surface molecules

Understanding lgt's role provides insight into the broader virulence mechanisms employed by this increasingly important opportunistic pathogen.

What bioinformatic approaches can reveal novel insights about Fusobacterium nucleatum lgt in comparative genomic analyses?

Several bioinformatic approaches provide valuable insights into F. nucleatum lgt:

  • Sequence Similarity Networks:

    • Enable identification of protein subfamilies and functional clustering

    • Revealed clear differentiation between predicted outer membrane adhesins, serine proteases, and proteins with unknown function in F. nucleatum

    • Can identify co-evolution patterns between lgt and its substrate lipoproteins

  • Structural Prediction and Modeling:

    • AlphaFold2 or RoseTTAFold can predict lgt structure based on sequence

    • Molecular dynamics simulations to understand membrane interactions

    • Substrate docking studies to identify binding pocket residues

  • Pangenome Analysis:

    • Examination of lgt conservation across F. nucleatum subspecies and strains

    • Identification of strain-specific variations that may correlate with virulence

    • A study of nine Fusobacterium genomes revealed that genes larger than 3kb had high error rates, highlighting the importance of proper genome assembly for accurate gene prediction

  • Transcriptomic Integration:

    • Analysis of lgt expression under different conditions (e.g., biofilm vs. planktonic, exposure to host cells)

    • Co-expression network analysis to identify functional partners

    • Correlation with virulence phenotypes in different disease models

These approaches provide a comprehensive view of lgt's evolutionary history, functional relationships, and potential as a therapeutic target.

How can the study of Fusobacterium nucleatum lgt contribute to our understanding of bacterial lipoprotein processing across different phylogenetic groups?

The study of F. nucleatum lgt offers unique insights into bacterial lipoprotein processing evolution:

  • Evolutionary Conservation Patterns:

    • Despite the 24% sequence identity between phylogenetically distant species like S. aureus and E. coli, lgt maintains functional conservation

    • F. nucleatum represents an interesting phylogenetic position for comparative studies with both Proteobacteria and Firmicutes

  • Subspecies Variation Analysis:

    • F. nucleatum subspecies show distinct virulence profiles, with subspecies animalis clade 2 specifically associated with colorectal cancer

    • Comparison of lgt across these subspecies may reveal adaptations for specific host niches

  • Lipoprotein Trafficking System Interactions:

    • In some species, the Lol pathway components (LolCDE vs. LolDF) determine the essentiality of subsequent lipoprotein processing steps

    • Understanding F. nucleatum's system could reveal evolutionary transitions in these pathways

  • Host-Microbe Interaction Implications:

    • Experimental validation often contradicts bioinformatic predictions of virulence potential

    • For example, F. necrophorum lacking a predicted Fap2 adhesin still strongly binds human colonocytes, suggesting alternative mechanisms

    • Comparison of F. nucleatum lgt with related pathogens may reveal niche-specific adaptations

This research contributes to understanding both bacterial evolution and the mechanisms of bacterial adaptation to different host environments.

What technical challenges exist in studying recombinant Fusobacterium nucleatum lgt, and how can they be addressed?

Studying recombinant F. nucleatum lgt presents several technical challenges:

  • Expression Difficulties:

    • Challenge: As a membrane protein from an anaerobic bacterium, expression in conventional systems may yield poor results

    • Solution: Use specialized expression hosts (C41/C43 E. coli strains), membrane-targeted fusion tags (MBP), and controlled expression conditions

  • Functional Assay Limitations:

    • Challenge: Direct activity measurement requires specialized substrates and detection methods

    • Solution: Develop fluorescent or colorimetric high-throughput assays using synthetic peptide substrates

  • Protein Stability Issues:

    • Challenge: Membrane proteins often show limited stability when purified

    • Solution: Screen multiple detergents and lipid nanodisc systems for optimal stability

  • Structural Analysis Barriers:

    • Challenge: Obtaining crystal structures of membrane proteins is notoriously difficult

    • Solution: Employ cryo-EM, NMR for specific domains, or computational modeling approaches

  • Biological Relevance Verification:

    • Challenge: Confirming the relevance of in vitro findings to F. nucleatum physiology

    • Solution: Develop genetic tools for F. nucleatum manipulation, potentially using CRISPR-Cas systems adapted for anaerobes

Addressing these challenges requires an interdisciplinary approach combining molecular biology, biochemistry, structural biology, and computational methods.

How might inhibitors of Fusobacterium nucleatum lgt be designed and evaluated as potential therapeutic agents?

Development of F. nucleatum lgt inhibitors requires a systematic approach:

  • Target Validation Strategy:

    • Confirm essentiality or virulence contribution of lgt in F. nucleatum

    • Determine conservation of catalytic site across human microbiome species

    • Assess potential off-target effects on beneficial microbiota

  • Inhibitor Design Approaches:

    • Structure-based design targeting the conserved H-103-GGLIG-108 motif

    • High-throughput screening of chemical libraries

    • Peptidomimetic approach based on lipobox recognition sequence

    • Natural product screening from antimicrobial sources

  • Evaluation Pipeline:

    • In vitro enzymatic inhibition assays with purified recombinant lgt

    • Cell-based assays measuring lipoprotein processing in F. nucleatum

    • Effects on bacterial adhesion to human cell lines (e.g., HTR8/SVneo, colorectal cell lines)

    • Assessment of F. nucleatum growth inhibition and biofilm formation

  • Therapeutic Potential Assessment:

    • Selectivity for F. nucleatum over other microbiome members

    • Pharmacokinetic properties for gut or oral cavity targeting

    • Effects on F. nucleatum-induced cytokine responses (IL-6, IL-8, CXCL1)

    • Impact on F. nucleatum-associated changes in gut metabolites, particularly butyric acid levels

This research direction could yield novel antimicrobials specifically targeting F. nucleatum in colorectal cancer or inflammatory conditions.

What role might F. nucleatum lgt play in the bacterium's effects on cell cycle regulation in host cells?

F. nucleatum influences host cell cycle regulation through multiple mechanisms, potentially involving lgt-processed lipoproteins:

  • Observed Cell Cycle Effects:

    • F. nucleatum increases the frequency of HTR8/SVneo cells in G2/M phase

    • In JEG-3 and BeWo cells, F. nucleatum increases the G0/G1 phase population

    • In colorectal cancer cells, butyric acid reduction (caused by F. nucleatum) prevents cells from entering G1 phase

  • Signaling Pathways Affected:

    • F. nucleatum induces NF-κB and β-catenin nuclear translocation

    • These pathways are critical regulators of cell proliferation and survival

    • The effects are partially TLR4-dependent and partially E-cadherin-dependent

  • Concentration-Dependent Effects:

    • Low F. nucleatum concentrations promote invasion and beneficial signaling

    • Higher concentrations inhibit migration, reduce viability, and alter cell cycle

    • This suggests a complex role in the regulation of host cell physiology

  • Potential lgt Contribution:

    • Properly processed lipoproteins may serve as TLR ligands or adhesins

    • lgt-dependent surface molecules could mediate direct interactions with host receptors

    • Inhibition of lgt could potentially modulate these effects on host cell cycle

Understanding this relationship could provide insights into F. nucleatum's role in both pregnancy complications and cancer progression.

How might emerging technologies advance our understanding of Fusobacterium nucleatum lgt function and regulation?

Several emerging technologies offer promising avenues for F. nucleatum lgt research:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of membrane-embedded lgt

    • Visualization of substrate binding and conformational changes during catalysis

    • Potential for structure-based drug design targeting specific functional domains

  • Single-Cell Technologies:

    • Single-cell RNA-seq to examine heterogeneity in lgt expression within F. nucleatum populations

    • Spatial transcriptomics to map lgt expression in the context of biofilms or host tissues

    • Live-cell imaging with fluorescent reporters to track lgt activity in real-time

  • Synthetic Biology Approaches:

    • Development of genetic tools for F. nucleatum manipulation

    • CRISPR interference systems for controlled lgt expression

    • Engineered strains with modified lgt activity to assess virulence contribution

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to place lgt in the context of broader cellular processes

    • Host-microbe interaction models incorporating lgt function

These technologies could overcome current limitations in studying this anaerobic pathogen and provide unprecedented insights into lgt biology.

What is the relationship between Fusobacterium nucleatum lgt activity and bacterial adaptation to different host environments?

F. nucleatum's ability to thrive in diverse host niches may depend on lgt-mediated lipoprotein processing:

  • Niche-Specific Adaptations:

    • Oral cavity vs. gut colonization may require different surface lipoprotein profiles

    • Placental invasion involves specific interactions with trophoblasts

    • Colorectal cancer association suggests adaptation to the tumor microenvironment

  • Host Immune Evasion Strategies:

    • Properly processed lipoproteins may modulate immune recognition

    • F. nucleatum's immunosuppressive capacity could involve lgt-dependent factors

    • Different subspecies show varying virulence profiles potentially related to lipoprotein processing

  • Metabolic Adaptation Considerations:

    • F. nucleatum alters the gut microbiome composition and metabolite profile

    • Surface lipoproteins may be involved in nutrient acquisition in different environments

    • Adaptation to changing oxygen levels as F. nucleatum transitions between niches

  • Co-evolution with Host Factors:

    • Interaction with specific human receptors (e.g., E-cadherin, TLR4)

    • Potential subspecies-specific adaptations to different human populations

    • Evolution of lipoproteins to optimize host cell binding and invasion

This research direction could provide insights into F. nucleatum's evolutionary history and pathogenic potential across different human diseases.

How does the lipoprotein processing pathway in Fusobacterium nucleatum compare with the canonical pathways described in model organisms?

F. nucleatum's lipoprotein processing pathway shows both similarities and differences compared to model organisms:

FeatureModel Organisms (E. coli)Fusobacterium nucleatumSignificance
Lgt FunctionS-diacylation of prolipoproteinsPresumed similarConserved first step
LspA FunctionSignal peptide cleavagePresumed similarConserved second step
N-acylationPerformed by LntUnknown if presentMay affect trafficking
Lol PathwayLolCDE in E. coliUnknown compositionDetermines lipoprotein localization
EssentialityLgt essential in diderm bacteriaUnknown in F. nucleatumPotential antibiotic target
  • Pathway Components:

    • The first two enzymes (Lgt and LspA) are highly conserved across all bacteria

    • The presence and function of an Lnt homolog in F. nucleatum remains unclear

    • The composition of the Lol pathway (LolCDE vs. LolDF) could impact trafficking requirements

  • Evolutionary Considerations:

    • Most Gracilicutes use the LolDF system rather than LolCDE

    • F. nucleatum's phylogenetic position could provide insights into the evolution of these systems

    • Horizontal gene transfer may have influenced the composition of these pathways

  • Functional Implications:

    • Differences in the pathway could affect lipoprotein localization and function

    • Species-specific adaptations may optimize the pathway for F. nucleatum's lifestyle

    • Understanding these differences could reveal novel therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.