Recombinant Fusobacterium nucleatum subsp. nucleatum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; FN0920; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
htpX
Target Protein Sequence
MKGLAELKNKIVKAPHLNIFKIGTWVTMGLFATFLLVYIFVGDEMLNYYPLLILFAFGTP FISLMISKATVKRAYNIRMIGDGGASTEKEKLVVDTVTLLSQKLDLQKFPEIGVYPSNDI NAFATGASKNSAMVAVSQGLLNSMNETEIIGVLAHEMSHVVNGDMLTSSILEGFVSAFGV IATLPFLMGENNNRGRRAASSMATYYMVRNVANIFGKIVSSAYSRRREYGADKLAAEITD PSYMKSALLRLQEISEGRISLQNSDREFASFKITNNFSMGNIFGNLFASHPSLAKRIAAI ERMEKTTKK
Uniprot No.

Target Background

Database Links

KEGG: fnu:FN0920

STRING: 190304.FN0920

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Fusobacterium nucleatum HtpX homolog and what is its biological function?

The HtpX homolog in Fusobacterium nucleatum is a membrane-bound protease belonging to the M48 family of zinc metalloproteinases. Based on homology with the well-characterized Escherichia coli HtpX, this protease is likely involved in quality control of membrane proteins, particularly in eliminating malfolded or misassembled membrane proteins that could compromise membrane integrity and function . The protein plays a crucial role in maintaining cellular homeostasis under various stress conditions, including heat shock, which is reflected in the "htp" (high temperature protein) designation in its name.

The protease contains conserved domains typical of M48 family members, including zinc-binding motifs crucial for its catalytic activity. While the precise physiological substrates in F. nucleatum have not been fully characterized, the protease likely contributes to bacterial adaptation and survival under stress conditions by preventing the accumulation of defective membrane proteins.

How is the recombinant HtpX from F. nucleatum typically engineered for research purposes?

For research applications, F. nucleatum HtpX is commonly engineered as a recombinant protein with affinity tags to facilitate purification and detection. Researchers typically clone the htpX gene using PCR amplification with specifically designed primers containing appropriate restriction sites (such as BamHI and SmaI) . The gene is then inserted into expression vectors like pHT43 or similar plasmids that are compatible with various host systems .

Common modifications include:

  • Addition of histidine tags (His-6 or His-10) at either N- or C-terminus for metal affinity purification

  • Inclusion of epitope tags (such as Myc) for immunodetection purposes

  • Incorporation of fluorescent protein fusions for localization studies and real-time activity monitoring

These recombinant constructs are essential for detailed biochemical characterization and functional studies of the protease in controlled laboratory settings.

What structural features characterize the F. nucleatum HtpX homolog?

The structural features of F. nucleatum HtpX can be predicted through comparative analysis with E. coli HtpX and computational modeling approaches. The protein likely contains:

  • Four hydrophobic regions that potentially function as transmembrane segments, anchoring the protein in the cytoplasmic membrane

  • A catalytic domain containing the HEXXH zinc-binding motif characteristic of metalloproteinases

  • D3 pockets that are important for metal ion binding and substrate recognition

Advanced structural prediction tools such as AlphaFold3 have been employed to model the tertiary structure of HtpX homologs . CASTpFold analysis can further identify binding pockets and potential metal ion interactions, providing insights into the functional mechanics of the protein . These structural features are critical determinants of the enzyme's substrate specificity and catalytic efficiency.

What are the optimal expression systems and conditions for producing active recombinant F. nucleatum HtpX?

Based on studies with similar proteases, several expression systems have proven effective for recombinant production of membrane proteases like HtpX, with specific optimization required for the F. nucleatum homolog:

For bacterial expression:

  • E. coli BL21(DE3) or BL21 CodonPlus (DE3) RIL strains have shown superior expression for similar membrane proteins from F. nucleatum

  • Induction conditions using IPTG at lower concentrations (0.5-1.0 mM) and reduced temperatures (25°C rather than 37°C) for 8-12 hours can significantly improve protein folding and activity

  • The addition of zinc supplements to the growth medium may enhance metalloprotease activity

For enhanced expression:

  • Bacillus subtilis WB800N can serve as an alternative host, particularly advantageous for membrane proteases due to its lower endogenous protease activity

  • Codon optimization of the htpX gene for the expression host can improve translation efficiency and protein yield

Experimental data from related F. nucleatum proteins indicates that optimizing these parameters can result in significantly increased protein yields and enhanced catalytic activity, with reports of up to 61.9-fold increase in fermentation level for recombinant proteases compared to native expression .

How can researchers develop effective activity assays for F. nucleatum HtpX?

Developing sensitive and specific activity assays for F. nucleatum HtpX presents a significant challenge due to limited knowledge of its natural substrates. Based on methodologies developed for E. coli HtpX, researchers can implement several approaches:

In vivo assay systems:

  • Construction of model substrates containing reporter proteins (such as GFP variants) fused to transmembrane segments

  • Development of substrates that generate differentially detectable cleavage products (N-terminal and C-terminal fragments) upon proteolysis

  • Monitoring substrate degradation using western blotting with antibodies against the reporter tags

In vitro biochemical assays:

  • Fluorogenic peptide substrates containing sequences predicted to be recognized by HtpX

  • FRET-based (Förster Resonance Energy Transfer) substrates for real-time monitoring of proteolytic activity

  • Mass spectrometry-based analyses to identify cleavage sites and characterize substrate specificity

The E. coli HtpX model substrate approach has proven particularly valuable, enabling semiquantitative and convenient detection of differential protease activities of various HtpX mutants . Adapting this methodology for F. nucleatum HtpX would provide researchers with powerful tools to investigate this protease's function and regulation.

What strategies exist for generating and validating F. nucleatum HtpX mutants?

Creating defined mutants is crucial for elucidating structure-function relationships in HtpX. Several approaches have been documented:

Gene inactivation strategies:

  • Single homologous recombination using integration plasmids (like pHS31) carrying resistance markers (such as thiamphenicol resistance)

  • Construction of gene fragments (e.g., aim1′) for targeted disruption

  • Confirmation of disruption through transcriptional analyses to verify altered gene expression

Site-directed mutagenesis approaches:

  • Targeting conserved motifs, particularly the zinc-binding HEXXH motif

  • Altering predicted substrate-binding regions identified through computational analysis

  • Modifying transmembrane domains to assess their role in protein localization and function

Validation methodologies:

  • Phenotypic analyses comparing mutant strains to parental strains using standardized activity assays

  • Complementation studies to confirm that observed phenotypes are specifically due to the introduced mutations

  • Structural analyses to determine how mutations affect protein folding and substrate binding

These mutational approaches have successfully demonstrated the contribution of specific proteins to F. nucleatum functions, such as the 41% decrease in apoptosis induction observed after aim1 disruption . Similar strategies would be valuable for determining critical functional regions of F. nucleatum HtpX.

What computational methods are most effective for predicting functional properties of F. nucleatum HtpX?

Several computational tools have proven valuable for analyzing structural and functional properties of proteases like F. nucleatum HtpX:

Structural prediction tools:

  • AlphaFold3 has been successfully employed to model the tertiary structure of similar proteases

  • CASTpFold analysis can identify crucial binding pockets, particularly the D3 pocket involved in metal ion binding

  • Molecular dynamics simulations to assess protein flexibility and conformational changes upon substrate binding

Functional annotation tools:

  • InterPro server for conserved domain analysis and functional classification

  • BLAST and other homology-based tools for identifying functional similarities with characterized proteases

  • Protein-protein interaction prediction algorithms to identify potential binding partners and substrates

Visualization and analysis software:

  • PyMOL for visualization and analysis of tertiary structures

  • Bioinformatics platforms that combine multiple prediction algorithms to enhance accuracy

Implementing these computational approaches provides a foundation for experimental design, helping researchers target specific protein regions for mutagenesis and functional characterization.

How does F. nucleatum HtpX potentially contribute to bacterial pathogenesis?

While direct evidence for F. nucleatum HtpX's role in pathogenesis is limited, insights can be inferred from the organism's disease associations and the general functions of membrane proteases:

F. nucleatum is associated with multiple pathological conditions, including:

  • Periodontal disease progression and inflammation

  • Colorectal cancer (CRC) development and metastasis

  • Various other inflammatory conditions and infections

As a membrane protease involved in protein quality control, HtpX may contribute to pathogenesis through:

  • Maintaining membrane integrity under host-induced stress conditions

  • Processing of virulence factors required for host colonization

  • Modulation of surface proteins that interact with host immune cells

  • Adaptation to changing environments during infection progression

Similar to other F. nucleatum virulence factors like Fap2 (which induces apoptosis in lymphocytes) , HtpX may play indirect roles in pathogenesis by ensuring bacterial survival and adaptation during host colonization. Further research using defined htpX mutants and functional assays would help elucidate its specific contributions to F. nucleatum virulence.

What are the most effective purification strategies for obtaining active recombinant F. nucleatum HtpX?

Purification of membrane proteases like HtpX presents unique challenges due to their hydrophobic nature. Based on successful approaches with similar proteins, a multi-step purification strategy is recommended:

Initial extraction:

  • Careful cell lysis using methods that preserve protein structure and activity

  • Selection of appropriate detergents for membrane protein solubilization

  • Optimization of buffer conditions (pH, salt concentration, reducing agents)

Chromatographic purification:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

  • Size exclusion chromatography for final polishing and buffer exchange

  • Ion exchange chromatography as an additional purification step if needed

Quality assessment:

  • SDS-PAGE analysis to verify protein purity (with targets of >90% purity)

  • Western blotting to confirm identity of purified protein

  • Activity assays to confirm that the purified protein retains enzymatic function

For recombinant proteases similar to HtpX, these approaches have yielded preparations with approximately 90% purity after gel filtration chromatography, while maintaining biological activity as demonstrated by phosphate group acceptance from histidine kinases and DNA binding capabilities .

What analytical methods are suitable for characterizing the catalytic properties of F. nucleatum HtpX?

Comprehensive characterization of HtpX catalytic properties requires multiple analytical approaches:

Kinetic analysis:

  • Determination of reaction velocity parameters (Km, Vmax, kcat) using model substrates

  • Evaluation of pH and temperature optima for enzymatic activity

  • Assessment of metal ion requirements and inhibitor sensitivity

Binding studies:

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding constants

  • Fluorescence-based binding assays for protein-protein and protein-substrate interactions

  • Analytical ultracentrifugation to assess oligomerization states

Structural assessments:

  • Circular dichroism spectroscopy to analyze secondary structure composition

  • Limited proteolysis combined with mass spectrometry to identify flexible regions

  • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics

For similar proteins from F. nucleatum, binding constant analyses have revealed interaction parameters such as Kd values of approximately 2.1 μM for binding to corresponding kinases and 6.4 μM for DNA operon binding . Similar approaches would provide valuable insights into HtpX substrate recognition and catalytic mechanisms.

How can F. nucleatum HtpX research contribute to understanding bacterial adaptation mechanisms?

Research on F. nucleatum HtpX has broader implications for understanding fundamental bacterial adaptation processes:

Stress response mechanisms:

  • Investigation of HtpX regulation under various stress conditions (heat, oxidative stress, host defense factors)

  • Comparison with stress response pathways in other pathogenic bacteria

  • Role in maintaining proteostasis during environmental transitions

Membrane protein quality control:

  • Identification of natural substrates of HtpX in F. nucleatum membranes

  • Integration with other quality control pathways and proteases

  • Comparison with equivalent systems in other bacterial species

Evolutionary aspects:

  • Comparative analysis of HtpX homologs across bacterial species

  • Investigation of selective pressures on membrane protease evolution

  • Identification of conserved and species-specific features

These investigations would contribute to fundamental understanding of bacterial adaptation mechanisms, potentially revealing conserved principles of membrane protein quality control that operate across diverse bacterial species.

What potential exists for developing HtpX-targeted antimicrobial strategies?

As antibiotic resistance continues to emerge as a global health challenge, novel targets like HtpX may offer opportunities for antimicrobial development:

Therapeutic potential:

  • HtpX inhibitors might disrupt bacterial membrane protein homeostasis

  • Combination approaches targeting multiple stress response systems

  • Potential for species-selective targeting based on structural differences

Rational drug design approaches:

  • Structure-based design of inhibitors targeting the catalytic site

  • Allosteric inhibitors affecting protein-protein interactions or conformational changes

  • Peptidomimetics designed to compete with natural substrates

Validation strategies:

  • Development of high-throughput screening assays for inhibitor discovery

  • In vitro and in vivo models to evaluate efficacy against F. nucleatum

  • Assessment of resistance development potential

While direct evidence for HtpX as an antimicrobial target is currently limited, its likely essential role in membrane protein quality control makes it a theoretically promising candidate for further investigation in antimicrobial development efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.