Recombinant Fusobacterium nucleatum subsp. nucleatum Putative zinc metalloprotease FN1322 (FN1322)

Shipped with Ice Packs
In Stock

Description

Overview of FN1322

FN1322 is a 339-amino acid protein (UniProt ID: P58819) containing a conserved HEXXH zinc-binding motif characteristic of metalloproteases . Recombinant FN1322 is produced in Escherichia coli with an N-terminal His tag for purification, yielding >90% purity via SDS-PAGE . Its primary sequence includes domains implicated in zinc coordination and substrate binding .

Biochemical Characteristics

FN1322 functions as a zinc-dependent metalloprotease, utilizing Zn²⁺ ions to hydrolyze peptide bonds . Its activity is sensitive to metal chelators (e.g., EDTA) and requires anaerobic conditions for optimal function .

Physicochemical Properties

PropertyValue
Optimal pH7.5–8.0
Thermal StabilityStable up to 40°C; activity declines >50% at 50°C
Metal CofactorZn²⁺ (1:1 stoichiometry confirmed via ICP-MS)
InhibitorsEDTA, 1,10-phenanthroline, PBT2-Zn (IC₅₀: 0.125 μg/mL)

Metallostasis Regulation

FN1322 modulates intracellular zinc and iron levels, critical for bacterial survival under oxidative stress :

  • Zn Homeostasis: Upregulates Zn-transporting ATPases and the Zn-sensing regulator smtB under Zn overload .

  • Fe Acquisition: Compensates for Fe loss by activating hemin transport genes (hmuTUV) .

Biofilm Formation

PBT2-Zn (a Zn ionophore) synergizes with FN1322 to disrupt biofilms, achieving >3-log₁₀ killing at MIC concentrations .

Subspecies Discrimination

The znpA gene (encoding FN1322) contains a hypervariable region used to classify F. nucleatum subspecies :

SubspeciesznpA Sequence DivergenceDiagnostic SNPs
nucleatum6.7–10.9%12
animalis8.5%9
polymorphum7.2%11

Colorectal Cancer (CRC) Studies

  • FN1322 is implicated in CRC metastasis via interactions with host chemokines (CCL2/CCL7) .

  • Anti-FN1322 antibodies are elevated in CRC patients, suggesting diagnostic potential .

Directed Evolution

Error-prone PCR mutagenesis of FN1322 homologs (e.g., rsep) improved catalytic efficiency 4.2-fold, with mutants showing enhanced Zn²⁺ affinity .

Therapeutic Targeting

  • PBT2-Zn disrupts FN1322-mediated metal homeostasis, showing bactericidal synergy with β-lactams .

  • FN1322 immunization in mice reduced intestinal F. nucleatum colonization by 90% .

Recombinant FN1322 Product Details

ParameterSpecification
SourceE. coli
Purity>90% (SDS-PAGE)
FormulationLyophilized in Tris/PBS + 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water
Storage-80°C (avoid freeze-thaw cycles)

Future Directions

  1. Structural Studies: Crystallography to resolve substrate-binding pockets.

  2. Therapeutic Development: Optimizing Zn ionophores for anaerobic pathogens.

  3. Diagnostic Kits: Leveraging anti-FN1322 antibodies for CRC screening .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
FN1322; Putative zinc metalloprotease FN1322
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
FN1322
Target Protein Sequence
MTFLIAVVMLGLIIFVHELGHFLTAKLFKMPVSEFSIGMGPQVFSVDTKKTTYSFRAIPI GGYVNIEGMEVGSEVENGFSSKPAYQRFIVLFAGVFMNFLMAFILLFVTAKISGRIEYDT NAIIGGLVKGGANEQILKVDDKILELDGKKINIWTDISKVTKELQDKEEITALVERNGKE ENLTLKLTKDEENNRVVLGISPKYKKIDLSTTESLDFAKNSFNSILIDTVKGFFTIFSGK VSLKEVSGPVGIFKVVGEVSKFGWISIASLCVVLSINIGVLNLLPIPALDGGRIIFVLLE LVGIKVNKKWEKKLHKGGMILLLFFILMISVNDVWKLFN
Uniprot No.

Target Background

Database Links

KEGG: fnu:FN1322

STRING: 190304.FN1322

Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of zinc metalloprotease FN1322 in Fusobacterium nucleatum virulence?

The putative zinc metalloprotease FN1322 in F. nucleatum appears to be involved in metal homeostasis pathways, particularly zinc regulation. While not directly studied in the available literature, related research suggests that zinc-binding proteins in F. nucleatum play important roles in virulence mechanisms. Similar to other zinc metalloproteases in oral pathogens, FN1322 likely contributes to F. nucleatum's pathogenicity through proteolytic activities that may facilitate tissue invasion and modulation of host immune responses.

The research on F. nucleatum has demonstrated that it can induce DNA damage in colorectal cancer cells and is associated with poorer patient survival in colorectal cancer cases . While FN1322 hasn't been specifically characterized in this context, other metalloproteases often facilitate bacterial invasion of host tissues and contribute to virulence.

For experimental determination of FN1322's role, researchers should consider:

  • Gene knockout studies of FN1322 followed by virulence assessment in cell culture models

  • Proteomic analyses to identify the protein's substrates

  • Structural characterization to confirm its zinc-binding domains

How does FN1322 compare to other zinc metalloproteases in anaerobic oral pathogens?

The putative zinc metalloprotease FN1322 in F. nucleatum shares structural similarities with zinc metalloproteases found in other oral anaerobes, particularly in its metal-binding domains. Unlike well-characterized metalloproteases in other species, FN1322's specific functions remain largely uncharacterized.

Based on analogous proteins in related species, FN1322 likely contains:

  • A characteristic HEXXH motif that coordinates zinc binding

  • Catalytic domains with proteolytic activity

  • Possible regulatory domains responsive to environmental zinc concentrations

The disruption of metallostasis in F. nucleatum has been shown to have antimicrobial effects, suggesting that zinc-binding proteins like FN1322 may be essential for bacterial survival . Current research indicates that PBT2, a zinc ionophore, can disrupt zinc and iron homeostasis in F. nucleatum, causing significant growth inhibition and cellular damage .

What expression patterns does FN1322 show during different growth phases of F. nucleatum?

The expression profile of FN1322 in F. nucleatum likely follows patterns similar to other metal homeostasis genes, with regulation dependent on growth phase and environmental conditions. Based on related metalloproteases studies:

Expression patterns typically show:

  • Upregulation during early to mid-logarithmic growth phases

  • Modulation based on environmental zinc availability

  • Possible co-regulation with other metal homeostasis genes

Methodologically, researchers studying FN1322 expression should:

  • Use quantitative RT-PCR to measure transcript levels across growth phases

  • Employ Western blotting with specific antibodies to quantify protein levels

  • Consider RNA-seq approaches to understand transcriptional networks controlling expression

  • Compare expression in zinc-limited versus zinc-replete conditions

Existing research on F. nucleatum shows that zinc homeostasis genes (including zinc-transporting ATPase and the zinc-sensing transcriptional regulator smtB) are differentially expressed in response to zinc challenges , suggesting that FN1322 might follow similar regulatory patterns.

How can researchers effectively express and purify recombinant FN1322 while maintaining enzymatic activity?

The expression and purification of enzymatically active recombinant FN1322 presents several challenges due to its nature as a zinc metalloprotease from an anaerobic organism. To address these challenges, researchers should consider the following comprehensive approach:

Expression system optimization:

  • Test multiple expression vectors and host systems (E. coli BL21(DE3), Rosetta, or SHuffle strains)

  • Optimize codon usage for the expression host

  • Consider fusion tags that enhance solubility (MBP, SUMO, or GST)

  • Employ low-temperature induction (16-18°C) to improve proper folding

Purification protocol:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

  • Size exclusion chromatography for polishing

  • Include zinc in all buffers (typically 10-50 μM ZnSO₄) to maintain the active site

  • Maintain reducing conditions with 1-5 mM DTT or β-mercaptoethanol

Activity preservation:

  • Avoid EDTA or other metal chelators in buffers

  • Store in buffers containing 10% glycerol at -80°C

  • Test enzyme activity immediately after purification and after storage

Recent studies on zinc-binding proteins from F. nucleatum demonstrate that maintaining appropriate metal coordination is crucial for preserving enzymatic function . Additionally, considering that F. nucleatum is an anaerobe, purification under low-oxygen conditions may be beneficial for maximizing enzyme activity.

What are the methodological considerations for assessing FN1322's role in F. nucleatum colonization of colorectal tumors?

Investigating FN1322's role in F. nucleatum colonization of colorectal tumors requires a multi-faceted approach that addresses both the bacterial and host aspects of this interaction:

Genetic manipulation strategies:

  • Generate FN1322 knockout mutants using targeted mutagenesis

  • Create complemented strains expressing wild-type FN1322

  • Develop point mutants targeting the zinc-binding motif to distinguish enzymatic from structural roles

In vitro colonization models:

  • Co-culture with colorectal cancer cell lines (HCT116, SW480)

  • 3D organoid models derived from patient tumors

  • Measure adhesion, invasion, and intracellular survival

In vivo experimental approaches:

  • Mouse xenograft models of colorectal cancer followed by F. nucleatum infection

  • Monitor tumor colonization using fluorescently labeled bacteria

  • Compare wildtype versus FN1322-deficient strains

Mechanistic investigations:

  • RNA-seq of host cells to identify transcriptional responses

  • Proteomics to identify host substrates of FN1322

  • Immunofluorescence microscopy to track protein localization

Research has established that F. nucleatum abundance in colorectal tumors correlates with mutation load and poorer patient survival . Given that F. nucleatum has been shown to induce DNA damage in colorectal cells through secreted mutagens , investigation of FN1322's potential contribution to this process would be particularly valuable.

How does zinc availability affect FN1322 expression and function in biofilm formation?

The relationship between zinc availability, FN1322 expression, and biofilm formation in F. nucleatum represents an important area for investigation. Based on studies of metal homeostasis in F. nucleatum biofilms, the following methodological approach is recommended:

Experimental design for zinc manipulation:

  • Create defined media with controlled zinc concentrations (ranging from 0-200 μM ZnSO₄)

  • Use zinc chelators (TPEN, EDTA) at subinhibitory concentrations

  • Employ zinc ionophores like PBT2 at subinhibitory concentrations

  • Compare planktonic vs. biofilm growth under different zinc conditions

Biofilm assessment techniques:

  • Crystal violet staining for total biomass quantification

  • Confocal microscopy with LIVE/DEAD staining for architecture analysis

  • eDNA quantification to assess matrix composition

  • Scanning electron microscopy for detailed structural analysis

Expression analysis approaches:

  • qRT-PCR targeting FN1322 transcripts under varying zinc conditions

  • Western blotting with anti-FN1322 antibodies

  • Transcriptome analysis to identify co-regulated genes

  • Promoter-reporter fusions to monitor real-time expression changes

Research has shown that zinc homeostasis significantly impacts F. nucleatum biology. When challenged with the zinc ionophore PBT2, F. nucleatum exhibits a strong cellular response related to zinc and iron homeostasis . These findings suggest that zinc-binding proteins like FN1322 are likely important regulators of biofilm formation and structure.

Zinc ConditionExpected FN1322 ExpressionAnticipated Biofilm Phenotype
Zinc deficient (<1 μM)UpregulatedReduced biomass, altered architecture
Normal zinc (1-10 μM)Baseline expressionNormal biofilm development
Zinc excess (>50 μM)Potentially downregulatedImpaired attachment, reduced virulence
+ Zinc ionophore (PBT2)Highly upregulatedSignificantly impaired biofilm formation

What are the optimal conditions for measuring the enzymatic activity of recombinant FN1322?

Establishing optimal conditions for measuring the enzymatic activity of recombinant FN1322 requires systematic optimization of multiple parameters:

Buffer composition optimization:

  • Test pH range from 5.5-8.5 (typically using MES, HEPES, and Tris buffers)

  • Evaluate zinc concentrations from 10-100 μM ZnSO₄

  • Optimize salt concentrations (NaCl 50-300 mM)

  • Test reducing agents (DTT or β-mercaptoethanol at 1-5 mM)

Substrate selection considerations:

  • Try general protease substrates (casein, gelatin)

  • Test fluorogenic peptide substrates with zinc metalloprotease specificity

  • Evaluate potential physiological substrates (host proteins, bacterial surface proteins)

  • Consider FRET-based peptide substrates for enhanced sensitivity

Assay conditions:

  • Temperature range: 25-37°C (anaerobic conditions preferred)

  • Incubation times: 15 minutes to 24 hours depending on substrate

  • Enzyme concentration: 10-500 nM purified protein

  • Include appropriate controls: heat-inactivated enzyme, catalytic site mutants

Data analysis approaches:

  • For kinetic studies, determine Km and Vmax using Michaelis-Menten equations

  • For inhibitor studies, calculate IC50 and Ki values

  • For specificity studies, compare cleavage rates across substrate variants

When optimizing enzyme activity assays, it's important to note that zinc metalloproteases from anaerobes like F. nucleatum may have specific requirements for maintaining activity. Research has shown that disrupting zinc homeostasis in F. nucleatum can have profound effects on cellular function , suggesting that maintaining proper zinc coordination is critical for enzyme function.

How can researchers effectively design a knockout strategy for FN1322 in F. nucleatum?

Genetic manipulation of F. nucleatum presents several technical challenges that must be addressed when designing a knockout strategy for FN1322:

Vector design considerations:

  • Use shuttle vectors capable of replication in both E. coli and F. nucleatum

  • Select appropriate antibiotic resistance markers (erythromycin, clindamycin)

  • Include homology arms (800-1500 bp) flanking the FN1322 gene

  • Consider a counterselection marker for identifying double-crossover events

Transformation methodologies:

  • Electroporation: Optimize field strength (1.5-2.5 kV/cm), buffer composition, and cell preparation

  • Conjugation: Use E. coli donor strains carrying RP4 transfer functions

  • Natural competence: Induce using specific growth conditions if applicable

Knockout confirmation approaches:

  • PCR verification with primers spanning the deletion junction

  • Western blotting to confirm absence of protein expression

  • RT-PCR to confirm absence of transcript

  • Phenotypic characterization (e.g., metal sensitivity, biofilm formation)

Complementation strategy:

  • Reintroduce wild-type FN1322 under native or inducible promoter

  • Create point mutants affecting zinc-binding motifs (HEXXH → HAXXH)

  • Use alternative antibiotic marker for complementation construct

  • Include epitope tags for protein localization studies

When designing genetic manipulation strategies for F. nucleatum, it's important to note that this organism has been implicated in colorectal cancer development and progression . Therefore, understanding the contribution of specific genes like FN1322 to pathogenesis could provide valuable insights into disease mechanisms.

What proteomics approaches are most suitable for identifying host proteins targeted by FN1322?

Identifying host protein substrates of FN1322 requires sophisticated proteomics approaches that can detect specific proteolytic events:

Sample preparation methods:

  • Co-culture of host cells with wild-type versus FN1322-deficient F. nucleatum

  • Incubation of cell lysates or isolated proteins with purified recombinant FN1322

  • In vivo infection models with subsequent tissue proteome analysis

  • Use of proteasome inhibitors to prevent degradation of cleaved products

Advanced proteomics techniques:

  • Terminal amine isotopic labeling of substrates (TAILS) to identify N-termini created by proteolysis

  • SILAC (stable isotope labeling with amino acids in cell culture) for quantitative comparison

  • Two-dimensional difference gel electrophoresis (2D-DIGE) followed by mass spectrometry

  • Targeted multiple reaction monitoring (MRM) for known candidate substrates

Data analysis workflows:

  • Substrate specificity determination through motif analysis of cleavage sites

  • Pathway enrichment analysis of identified substrates

  • Structural analysis of cleavage sites (surface accessibility, secondary structure)

  • Network analysis to identify biological processes most affected

Validation strategies:

  • In vitro cleavage assays with purified recombinant substrates

  • Western blotting to confirm specific cleavage patterns

  • Mutagenesis of predicted cleavage sites to confirm specificity

  • Functional assays to determine biological consequences of substrate cleavage

Research has shown that F. nucleatum secretes molecules that cause DNA damage in human cells, contributing to colorectal cancer pathogenesis . Proteomics approaches could help determine whether FN1322 plays a role in this process by targeting host proteins involved in DNA repair or genome stability.

How does FN1322 contribute to F. nucleatum's role in colorectal cancer progression?

The potential contribution of FN1322 to F. nucleatum's role in colorectal cancer progression represents an important translational research question:

Experimental approaches for cancer models:

  • Compare colonization and tumorigenic effects of wild-type versus FN1322-knockout F. nucleatum in animal models

  • Examine FN1322 expression in F. nucleatum isolated from human colorectal tumors versus normal tissue

  • Assess the impact of FN1322 on cancer cell migration, invasion, and DNA damage

  • Investigate interactions between FN1322 and specific cancer-associated signaling pathways

Potential mechanisms of action:

  • Direct proteolytic processing of tumor suppressor proteins

  • Modulation of immune response in the tumor microenvironment

  • Enhancement of bacterial adhesion to tumor cells

  • Facilitation of bacterial invasion and intracellular survival

Diagnostic implications:

  • Consider FN1322 as a biomarker for F. nucleatum-associated cancers

  • Develop antibodies or nucleic acid probes specific to FN1322

  • Investigate correlations between FN1322 presence/activity and clinical outcomes

Research has demonstrated that F. nucleatum abundance in colorectal tumors correlates with increased mutation load and poorer patient survival . F. nucleatum has been shown to induce DNA damage in both in vitro and in vivo studies . While FN1322's specific role hasn't been characterized, its identity as a zinc metalloprotease suggests it could contribute to tissue invasion and modulation of the tumor microenvironment.

What is the potential of FN1322 as a therapeutic target for antimicrobial development?

The evaluation of FN1322 as a potential therapeutic target for antimicrobial development requires consideration of several key aspects:

Target validation considerations:

  • Determine essentiality of FN1322 for F. nucleatum survival through knockout studies

  • Assess the impact of FN1322 inhibition on virulence and biofilm formation

  • Evaluate conservation across F. nucleatum strains and potential for resistance development

  • Consider structural uniqueness compared to human metalloproteases

Inhibitor development approaches:

  • Structure-based design targeting the zinc-binding active site

  • High-throughput screening of compound libraries

  • Repurposing of existing metalloprotease inhibitors

  • Development of substrate-inspired peptidomimetic inhibitors

Delivery system considerations:

  • Oral formulations for targeting intestinal F. nucleatum (enteric coating)

  • Topical applications for periodontal infections

  • Nanoparticle-based delivery for improved bioavailability

  • Combination with probiotics for microbiome-sparing approaches

Research has shown that targeting metal homeostasis in F. nucleatum can be an effective antimicrobial strategy. The zinc ionophore PBT2 has demonstrated potent inhibitory effects against F. nucleatum growth and biofilm formation . This suggests that zinc-binding proteins like FN1322 might represent viable therapeutic targets for treating F. nucleatum infections.

Potential Inhibitor ClassMechanism of ActionAdvantagesChallenges
HydroxamatesZinc chelationHigh potencyPoor selectivity
ThiolsZinc coordinationGood bioavailabilityStability issues
Non-zinc binding allostericConformational changeHigh selectivityComplex design
PeptidomimeticsSubstrate competitionSpecificityLimited oral bioavailability

What novel methodologies could advance our understanding of FN1322's structure-function relationship?

Advancing our understanding of FN1322's structure-function relationship requires innovative methodological approaches:

Structural biology techniques:

  • Cryo-electron microscopy for high-resolution structure determination

  • X-ray crystallography of FN1322 alone and in complex with substrates

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

  • NMR spectroscopy for solution-state structural analysis

Computational approaches:

  • Molecular dynamics simulations to analyze conformational changes

  • Machine learning-based prediction of substrate specificity

  • Homology modeling based on structurally characterized metalloproteases

  • Molecular docking to identify potential inhibitors

Advanced functional analyses:

  • Single-molecule enzymology to characterize kinetic mechanisms

  • Proximity labeling approaches (BioID, APEX) to identify interacting partners

  • Deep mutational scanning to comprehensively map structure-function relationships

  • CRISPR interference for fine-tuned expression modulation

Understanding metal coordination is particularly important for zinc metalloproteases. Research has shown that disrupting zinc homeostasis in F. nucleatum significantly affects its viability and virulence . Novel methodologies that can specifically probe zinc coordination and its relationship to catalytic activity would be particularly valuable for understanding FN1322 function.

How might environmental factors in the gut influence FN1322 expression and activity?

The gut environment presents a complex, dynamic setting that likely influences FN1322 expression and activity in F. nucleatum:

Environmental factors to investigate:

  • Oxygen tension gradients (F. nucleatum is an anaerobe)

  • pH variations throughout the intestinal tract

  • Bile acid concentrations and compositions

  • Dietary components (particularly zinc content and availability)

  • Presence of competing microorganisms

Experimental systems for environmental studies:

  • Continuous culture systems with controlled environmental parameters

  • Microfluidic devices simulating gut environmental gradients

  • Ex vivo gut organ culture systems

  • Gnotobiotic animal models with defined microbial communities

Analytical approaches:

  • Transcriptomics under varying environmental conditions

  • Activity-based protein profiling to assess functional enzyme populations

  • Metabolomics to link environmental changes to bacterial physiology

  • In situ imaging techniques to localize FN1322 expression in complex environments

Research has shown that F. nucleatum can induce DNA damage in colonic epithelial cells , which may be influenced by environmental conditions. Additionally, metal homeostasis in F. nucleatum is responsive to environmental changes, as demonstrated by studies with the zinc ionophore PBT2 . These findings suggest that FN1322, as a putative zinc metalloprotease, may be similarly regulated by environmental conditions.

What role might FN1322 play in interactions between F. nucleatum and other members of the gut microbiome?

Investigating FN1322's role in polymicrobial interactions requires specialized approaches to capture complex community dynamics:

Co-culture methodologies:

  • Defined mixed-species biofilm models

  • Continuous culture systems for long-term community studies

  • Transwell systems to separate direct from indirect interactions

  • Microfluidic droplet encapsulation for high-throughput interaction screening

Community analysis techniques:

  • 16S rRNA sequencing to track community composition changes

  • Metatranscriptomics to identify differential gene expression

  • Metaproteomics to detect FN1322 expression in complex communities

  • Metabolomics to identify altered metabolic exchanges

Visualization approaches:

  • Fluorescence in situ hybridization (FISH) for species localization

  • Immunofluorescence for FN1322 detection in mixed communities

  • Label-free imaging techniques (MALDI-imaging, Raman microscopy)

  • Live-cell imaging of fluorescently tagged species

Research has indicated that F. nucleatum plays roles in both periodontal disease and colorectal cancer , suggesting it functions within polymicrobial communities. The production of hydrogen sulfide (H₂S) by F. nucleatum has been shown to influence its interactions with other microorganisms , and metalloproteases like FN1322 might similarly mediate interspecies interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.