Recombinant Fusobacterium nucleatum subsp. nucleatum UPF0059 membrane protein FN1615 (FN1615)

Shipped with Ice Packs
In Stock

Description

Membrane Protein Families

  • UPF0059 Family: A group of conserved bacterial membrane proteins with unknown functions. FN1615’s structural features suggest involvement in transmembrane signaling or substrate transport .

  • Coaggregation Adhesins: F. nucleatum relies on outer membrane proteins (OMPs) like RadD, Fap2, and FadA for interspecies adherence and biofilm formation . Although FN1615 is distinct, its membrane localization hints at possible adhesive or immunomodulatory roles.

Comparative Analysis with Key F. nucleatum Proteins

ProteinGeneFunctionRelevance to FN1615
RadDradDArginine-inhibitable adhesin; mediates biofilm formation with streptococciBoth are OMPs, but RadD has defined adhesive roles .
FadAfadABinds E-cadherin; promotes colorectal cancer via Annexin A1 upregulationFN1615 lacks direct oncogenic associations .
Fap2fap2Induces lymphocyte apoptosis via outer membrane interactionsUnlike Fap2, FN1615 has no reported cytotoxic activity .

Hypothesized Roles

  1. Pathogenicity: Membrane proteins in F. nucleatum often mediate host-cell adhesion or immune evasion. FN1615 may contribute to bacterial colonization or persistence in oral/intestinal niches .

  2. Antigenic Potential: Recombinant FN1615 could serve as an antigen for antibody production, aiding in diagnostic assays or vaccine development against fusobacterial infections .

Experimental Use Cases

  • Structural Studies: Crystallization or cryo-EM to resolve its transmembrane topology .

  • Interaction Screens: Yeast two-hybrid assays to identify host or microbial binding partners.

Limitations and Knowledge Gaps

  • Functional Data: No direct studies confirm FN1615’s biological role. Its classification under UPF0059 implies conserved but uncharacterized functions .

  • Subspecies Variability: F. nucleatum subspecies (e.g., nucleatum, polymorphum) exhibit genetic diversity in adhesins . Whether FN1615 is conserved across subspecies remains unexplored.

Future Directions

  1. Knockout Models: Generate FN1615-deficient F. nucleatum strains to assess phenotypic changes in adhesion or virulence.

  2. Proteomic Profiling: Identify interacting host proteins using affinity purification-mass spectrometry.

  3. Immunogenicity Assays: Test recombinant FN1615’s ability to stimulate immune responses in vitro/in vivo.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; FN1615; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Target Names
mntP
Target Protein Sequence
MSTISVLITALALSMDAMSLSIYQGIASTESQKKQNFLKIVLTFGIFQFAMALVGSLSGI LFIHYISLYSKYVSFAIFLFLGLMMLKEALKKEEMEYDEKYLDFKTLIIMGIATSLDALL VGLTFSILPFYQTFLYTVEIGVITAIIAGLGFILGDKFGNILGQKSHFLGAALLIFISIN ILL
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux.
Database Links

KEGG: fnu:FN1615

STRING: 190304.FN1615

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fusobacterium nucleatum and why is the FN1615 membrane protein significant for research?

Fusobacterium nucleatum is a Gram-negative anaerobic bacillus found primarily in the oral microbiota but has also been implicated in colorectal cancer and other opportunistic infections. F. nucleatum has garnered significant attention in recent years due to its associations with colorectal cancer across various patient populations and disease stages .

The UPF0059 membrane protein FN1615 belongs to a family of membrane proteins that may play important roles in F. nucleatum's interactions with host cells and other microorganisms. As part of the membrane proteome, FN1615 represents a potential target for understanding F. nucleatum's virulence mechanisms, particularly in the context of its emerging role as an "oncobacterium" .

What are the current methods for expressing recombinant FN1615 protein?

Recombinant expression of F. nucleatum proteins presents several challenges due to the organism's anaerobic nature and specialized genetic requirements. Current methodologies include:

Expression Systems:

  • E. coli-based expression systems using specialized vectors

  • AIDA autotransporter domains for membrane protein translocation

  • TEV cleavage sites for protein purification

Purification Protocol:

  • Bacterial culture under optimized conditions

  • Cell lysis and membrane fraction isolation

  • Ni²⁺ affinity chromatography

  • TEV protease treatment

  • Secondary purification via glutathione affinity chromatography

This approach can yield high-purity recombinant protein suitable for structural and functional studies, as demonstrated with other F. nucleatum membrane proteins .

How can researchers verify the structural integrity of purified recombinant FN1615?

Verification of structural integrity for membrane proteins like FN1615 requires multiple complementary approaches:

What experimental controls should be included when working with recombinant FN1615?

When designing experiments with recombinant FN1615, several controls are essential:

  • Negative controls:

    • Empty vector-transformed E. coli to control for host cell protein contamination

    • Non-membrane F. nucleatum proteins to control for general bacterial protein effects

    • Buffer-only controls for functional assays

  • Positive controls:

    • Well-characterized F. nucleatum membrane proteins (such as Fap2 or RadD)

    • Commercial antibodies against His-tags or other fusion tags used

  • Validation controls:

    • Protease protection assays to confirm proper membrane topology

    • Multiple methods of protein detection (immunoblotting, mass spectrometry)

    • Functional complementation in F. nucleatum mutants lacking FN1615

These controls help ensure experimental rigor and reproducibility, which have been identified as challenges in F. nucleatum research .

What is the recommended experimental design for studying FN1615 interactions with host cells?

For studying FN1615 interactions with host cells, a block design experimental approach is recommended:

Block Design Experimental Setup:

  • Block preparation:

    • Purified recombinant FN1615 protein at multiple concentrations (1-10 μg/mL)

    • Control proteins (e.g., BSA, inactive FN1615 mutants)

    • Host cell types relevant to F. nucleatum ecology (e.g., oral epithelial cells, colorectal cells, immune cells)

  • Experimental blocks:

    • Fixed time periods (typically 30 min to 2 hours) for interaction studies

    • Multiple replicates per condition (minimum n=3)

    • Alternating with rest periods for baseline measurements

  • Data collection:

    • Multiple parameters measured per block (e.g., adhesion, invasion, host cell response)

    • Both immediate and delayed responses recorded

    • Consistent timing between blocks to capture the complete response

This design allows for statistical robustness while accommodating the biological variability inherent in host-microbe interaction studies . The block design is particularly valuable for capturing both transient and sustained effects of FN1615 on host cells.

How can researchers distinguish the specific effects of FN1615 from those of other F. nucleatum membrane proteins?

Distinguishing specific effects of FN1615 from other membrane proteins requires a multi-faceted approach:

  • Genetic approaches:

    • Generation of in-frame, nonpolar deletions of FN1615 using CRISPR-Cas9 or traditional methods

    • Complementation with wild-type FN1615 to restore phenotype

    • Domain-specific mutations to map functional regions

  • Biochemical approaches:

    • Immunoprecipitation with FN1615-specific antibodies

    • Competition assays with purified recombinant proteins

    • Cross-linking studies to capture direct interaction partners

  • Comparative studies:

    • Side-by-side testing with other membrane proteins (RadD, Fap2)

    • Bioinformatic analysis to identify unique structural features

    • Heterologous expression in non-F. nucleatum backgrounds

The genetic toolkit for F. nucleatum has improved significantly, with recent advances in transposon mutagenesis and techniques for generating deletion mutants , making these approaches increasingly feasible.

What considerations should be made when designing block experiments for FN1615 functional studies?

When implementing block design experiments for FN1615 functional studies, several key considerations should be addressed:

  • Block duration:

    • Should be sufficient to observe biological responses (typically 5-10 minutes for immediate responses, 30+ minutes for transcriptional changes)

    • Avoid excessively long blocks that may lead to signal saturation or plateau effects

  • Rest periods:

    • Should allow return to baseline conditions

    • Duration typically 1-2× the block period

    • Maintain consistent experimental conditions during rest to avoid confounding variables

  • Repetition:

    • Multiple blocks (3-5 minimum) to establish reproducible responses

    • Randomization of block order when testing multiple conditions

    • Statistical power calculations to determine adequate sample size

  • Technical considerations:

    • Control for periodic physiological confounds (e.g., cell cycle stage)

    • Maintain consistent temperature and buffer conditions

    • Include appropriate positive and negative controls in each block

Following these considerations ensures reliable and reproducible results while maximizing statistical power to detect biological effects of FN1615 .

How can proteomic approaches be applied to study FN1615 in the context of F. nucleatum pathogenesis?

Advanced proteomic approaches offer powerful tools for investigating FN1615 in F. nucleatum pathogenesis:

Quantitative Proteomics Methods:

  • Tandem Mass Tag (TMT) labeling with LC-MS/MS analysis:

    • Allows comparison of FN1615 expression under different conditions

    • Can identify post-translational modifications

    • Enables quantification of relative protein abundance changes

  • Outer Membrane Vesicle (OMV) proteomics:

    • Determines whether FN1615 is packaged into OMVs

    • Compares expression under neutral vs. acidic conditions (tumor microenvironment)

    • Identifies co-packaged proteins that may function with FN1615

  • Interactome analysis:

    • Identifies host and bacterial proteins that interact with FN1615

    • Maps interaction networks using proximity labeling approaches

    • Characterizes changes in interactions under different conditions

A recent study identified 991 proteins in F. nucleatum OMVs using TMT labeling-LC-MS/MS, with approximately 70% showing altered expression under acidic conditions typical of the tumor microenvironment . Similar approaches could reveal how FN1615 contributes to F. nucleatum adaptation to different host environments.

What structural characterization approaches are most suitable for membrane proteins like FN1615?

Membrane proteins like FN1615 present unique challenges for structural characterization. The following approaches are most suitable:

For proteins like Fap2, another F. nucleatum membrane protein, these approaches have revealed unique structural features such as a hydrophobic groove winding around the longitudinal axis and closing with an unstructured N-terminus . Similar structural insights could be gained for FN1615.

How might FN1615 contribute to F. nucleatum's role in colorectal cancer, and how can this be investigated?

The potential role of FN1615 in colorectal cancer can be investigated through several complementary approaches:

  • Clinical correlation studies:

    • Analysis of FN1615 expression in F. nucleatum isolates from colorectal cancer patients vs. healthy controls

    • Correlation of FN1615 expression levels with cancer progression and metastasis

    • Examination of FN1615 sequence variants in cancer-associated strains

  • Functional studies in cancer models:

    • Testing FN1615 effects on cancer cell proliferation, migration, and invasion

    • Evaluation of immune evasion mechanisms potentially facilitated by FN1615

    • Assessment of FN1615's role in modulating the tumor microenvironment

  • Mechanistic investigations:

    • Identification of host cell receptors or targets for FN1615

    • Characterization of signaling pathways activated by FN1615

    • Analysis of FN1615's potential role in bacterial aggregation or biofilm formation within tumors

F. nucleatum has been shown to shape the tumor microenvironment through various mechanisms that may be strain-specific . Understanding FN1615's potential contribution to these processes requires careful experimental design and control for strain variation, as different F. nucleatum isolates have shown conflicting observations in animal models of tumorigenesis .

What genetic tools are available for manipulating FN1615 expression in F. nucleatum, and what are their limitations?

The genetic toolkit for F. nucleatum has expanded in recent years, though significant challenges remain:

Available Genetic Tools:

TechniqueApplicationStrengthsLimitations
Transposon mutagenesisRandom gene disruptionNow demonstrated in F. nucleatum ATCC 23726 Limited to certain strains
In-frame deletion techniquesTargeted gene removalCreates nonpolar deletions Technically demanding, strain-specific
Campbell insertionInsertional inactivationRelatively straightforwardOften polar, prone to reversion
SonoporationDNA deliveryUnique approach for F. nucleatumLimited reproducibility across labs
CRISPR-Cas9Precise genome editingPotential for expedient deletionsStill being optimized for F. nucleatum

Limitations and Considerations:

  • Strain variability is a significant challenge - most genetic tools have only been validated in specific strains like F. nucleatum ATCC 23726, which has urogenital rather than oral or gastrointestinal origin

  • Inconsistent strain usage across studies complicates cross-study comparisons

  • The genetic recalcitrance of F. nucleatum requires continued development of specialized techniques

Future directions include the potential application of chemical mutagenesis with deep sequencing, similar to approaches used for genetically challenging bacteria like Chlamydia trachomatis .

What are the optimal conditions for expressing soluble recombinant FN1615 protein?

Optimizing expression conditions for recombinant FN1615 requires careful consideration of several parameters:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Vectors containing strong, inducible promoters (T7, tac)

  • Fusion tags that enhance solubility (MBP, SUMO) while facilitating purification (His6)

Culture Conditions:

  • Media: Typically LB or TB supplemented with appropriate antibiotics

  • Temperature: Lower temperatures (16-20°C) after induction often improve folding

  • Induction: Low IPTG concentrations (0.1-0.5 mM) for gentler induction

  • Duration: Extended expression periods (overnight) at lower temperatures

Extraction and Solubilization:

  • Gentle cell lysis using non-ionic detergents

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using detergents compatible with downstream applications:

    • n-Dodecyl β-D-maltoside (DDM)

    • Digitonin

    • Lauryl maltose neopentyl glycol (LMNG)

Stability Enhancement:

  • Addition of glycerol (10-20%) to all buffers

  • Inclusion of reducing agents (DTT, TCEP)

  • Temperature control during all purification steps (4°C)

Similar approaches have been successfully employed for other F. nucleatum membrane proteins, resulting in >90% purity suitable for structural and functional studies .

How can researchers address the challenges of reproducibility in F. nucleatum research?

Reproducibility challenges in F. nucleatum research can be addressed through several methodological approaches:

  • Standardization of strains and growth conditions:

    • Clear documentation of strain source, origin, and passage history

    • Consistent culture media and growth parameters across experiments

    • Verification of strain identity through genome sequencing

  • Robust experimental design:

    • Appropriate sample sizes based on power calculations

    • Inclusion of all necessary controls (positive, negative, technical)

    • Blinding of samples during analysis when possible

  • Methodological transparency:

    • Detailed documentation of all protocols, including specific reagents and equipment

    • Reporting of both positive and negative results

    • Sharing of raw data and analysis scripts

  • Validation across multiple methods:

    • Confirmation of findings using complementary techniques

    • Testing in multiple F. nucleatum strains when possible

    • Replication of key findings by independent researchers or labs

The challenge of reproducibility has been highlighted in F. nucleatum colorectal cancer research, where the Repass cancer replication study encountered difficulties in detecting F. nucleatum in colorectal cancer tissues across studies . This underscores the importance of methodology standardization and transparent reporting.

What analytical approaches are recommended for interpreting data from FN1615 interaction studies?

When analyzing data from FN1615 interaction studies, several analytical approaches are recommended:

  • Statistical methods:

    • Mixed-effects models to account for within-subject correlations in block design experiments

    • Multiple comparison corrections for simultaneous hypothesis testing

    • Non-parametric methods when assumptions of normality cannot be met

  • Visualization techniques:

    • Time-course plots to capture dynamic interactions

    • Heatmaps for multi-parameter correlation analysis

    • Network visualizations for protein-protein interaction data

  • Integration of multi-omics data:

    • Combined analysis of proteomics, transcriptomics, and functional data

    • Pathway enrichment analysis to identify biological processes

    • Comparison with published datasets on other F. nucleatum membrane proteins

  • Computational modeling:

    • Structure-based interaction prediction using homology models or AlphaFold2 predictions

    • Molecular dynamics simulations to predict conformational changes

    • Systems biology approaches to place findings in broader biological context

For block design experiments specifically, recommended analytical approaches include:

  • Mean amplitude calculations

  • Time-to-peak measurements

  • Area under the curve analysis

  • Block averaging to improve signal-to-noise ratio

These analytical approaches help extract meaningful biological insights while accounting for the technical variability inherent in complex interaction studies.

What are the most promising future research directions for understanding FN1615 function?

Several promising research directions could advance our understanding of FN1615 function:

  • Structural biology:

    • High-resolution structure determination using advances in cryo-EM

    • Mapping of functional domains through targeted mutagenesis

    • Identification of potential binding pockets for small molecule targeting

  • Host-microbe interactions:

    • Identification of host cell receptors or binding partners

    • Characterization of FN1615's role in biofilm formation or bacterial co-aggregation

    • Investigation of FN1615's potential role in immune modulation

  • Technological advances:

    • Application of CRISPR-Cas9 technologies for expedient deletions and defined library generation

    • Development of F. nucleatum-specific genetic tools that work across multiple strains

    • Application of chemical mutagenesis with deep sequencing approaches

  • Translational applications:

    • Assessment of FN1615 as a potential diagnostic marker for F. nucleatum-associated diseases

    • Evaluation as a therapeutic target to disrupt F. nucleatum colonization

    • Investigation as a potential component of vaccines targeting F. nucleatum

These directions build upon the current understanding of F. nucleatum membrane proteins while leveraging emerging technologies to address key knowledge gaps .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.